<? endif; ?>
<link rel="stylesheet" href="/css/proven.responsive.min.css?<?= filemtime(__DIR__.'/../../webroot/css/proven.responsive.min.css'); ?>" type="text/css" />
$viewFile = '/var/app/current/app/View/Layouts/responsive.ctp' $dataForView = array( 'location_text' => 'tulsa', 'employers' => array( (int) 0 => array( 'EmployersJob' => array( [maximum depth reached] ), 'Employer' => array( [maximum depth reached] ) ), (int) 1 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 2 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 3 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 4 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 5 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 6 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 7 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 8 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 9 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 10 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 11 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 12 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 13 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 14 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 15 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 16 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 17 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 18 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 19 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 20 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 21 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 22 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 23 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 24 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 25 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 26 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 27 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 28 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 29 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 30 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 31 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 32 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 33 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 34 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 35 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 36 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 37 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 38 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 39 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 40 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 41 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 42 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 43 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 44 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 45 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 46 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 47 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 48 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 49 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ), (int) 50 => array( 'Employer' => array( [maximum depth reached] ), 'UtZipcode' => array( [maximum depth reached] ), 'User' => array( [maximum depth reached] ), 'EmployersJob' => array( [maximum depth reached] ) ) ), 'search_text' => '', 'sort_by' => 'relevance', 'page' => '10', 'location_details' => array( 'id' => '367', 'name' => 'Northwest OK', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'lat' => '35.9420', 'lon' => '-95.8833', 'background_class' => 'generic-panel', 'key_value' => 'northwest OK', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9', 'created_date' => '2018-10-26 16:58:52', 'posting_fee' => '10.0000', 'city' => 'northwest OK' ), 'all_locations' => array( 'abilene' => array( 'name' => 'Monroe', 'city' => 'monroe', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.5093', 'lon' => '-92.1193', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'abilene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'akron / canton' => array( 'name' => 'Akron / Canton', 'city' => 'akron / canton', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.0814', 'lon' => '-81.5190', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'akron / canton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'albany' => array( 'name' => 'Albany', 'city' => 'albany', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5785', 'lon' => '-84.1557', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'albany', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'albuquerque' => array( 'name' => 'Albuquerque', 'city' => 'albuquerque', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.0844', 'lon' => '-106.6504', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'albuquerque', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'allentown' => array( 'name' => 'Allentown', 'city' => 'Allentown', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '40.6017', 'lon' => '-75.4772', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'allentown', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'altoona-johnstown' => array( 'name' => 'Altoona-Johnstown', 'city' => 'altoona-johnstown', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.5187', 'lon' => '-78.3947', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'altoona-johnstown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'amarillo' => array( 'name' => 'Amarillo', 'city' => 'amarillo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '35.1992', 'lon' => '-101.8453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'amarillo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ames' => array( 'name' => 'Ames', 'city' => 'ames', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0308', 'lon' => '-93.6319', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ames', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'anchorage / mat-su' => array( 'name' => 'Anchorage / Mat-su', 'city' => 'anchorage / mat-su', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '61.2167', 'lon' => '149.9000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'anchorage / mat-su', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ann arbor' => array( 'name' => 'Ann Arbor', 'city' => 'ann arbor', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.2814', 'lon' => '-83.7483', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ann arbor', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'annapolis' => array( 'name' => 'Annapolis', 'city' => 'Annapolis', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '38.9729', 'lon' => '-76.5012', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'annapolis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'appleton-oshkosh-FDL' => array( 'name' => 'Appleton-Oshkosh-FDL', 'city' => 'appleton-oshkosh-FDL', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.2667', 'lon' => '-88.4000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'appleton-oshkosh-FDL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'asheville' => array( 'name' => 'Asheville', 'city' => 'asheville', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.5800', 'lon' => '82.5558', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'asheville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ashtabula' => array( 'name' => 'Ashtabula', 'city' => 'ashtabula', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8651', 'lon' => '-80.7898', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ashtabula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'athens' => array( 'name' => 'Athens', 'city' => 'athens', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3292', 'lon' => '-82.1013', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'athens', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'atlanta' => array( 'name' => 'Atlanta', 'city' => 'atlanta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '33.7490', 'lon' => '-84.3900', 'background-class' => 'atlanta-panel', 'background_class' => 'atlanta-panel', 'key_value' => 'atlanta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'auburn' => array( 'name' => 'Auburn', 'city' => 'auburn', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.6099', 'lon' => '85.4808', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'auburn', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'augusta' => array( 'name' => 'Augusta', 'city' => 'augusta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '33.4735', 'lon' => '-82.0105', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'augusta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'austin' => array( 'name' => 'Austin', 'city' => 'Austin', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '30.2672', 'lon' => '-97.7431', 'background-class' => 'austin-panel', 'background_class' => 'austin-panel', 'key_value' => 'austin', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'bakersfield' => array( 'name' => 'Bakersfield', 'city' => 'bakersfield', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.3667', 'lon' => '-119.0167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bakersfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'baltimore' => array( 'name' => 'Baltimore', 'city' => 'Baltimore', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.2833', 'lon' => '-76.6167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'baltimore', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'baton rouge' => array( 'name' => 'Baton Rouge', 'city' => 'baton rouge', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '30.4500', 'lon' => '-91.1400', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'baton rouge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'battle creek' => array( 'name' => 'Battle Creek', 'city' => 'battle creek', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.3212', 'lon' => '-85.1797', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'battle creek', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'beaumont / port arthur' => array( 'name' => 'Beaumont / Port Arthur', 'city' => 'beaumont / port arthur', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.0013', 'lon' => '-94.1514', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'beaumont / port arthur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bellingham' => array( 'name' => 'Bellingham', 'city' => 'bellingham', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '48.7491', 'lon' => '-122.4781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bellingham', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bemidji' => array( 'name' => 'Bemidji', 'city' => 'bemidji', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4716', 'lon' => '-94.8827', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bemidji', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bend' => array( 'name' => 'Bend', 'city' => 'bend', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.0582', 'lon' => '-121.3153', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bend', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'billings' => array( 'name' => 'Billings', 'city' => 'billings', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '45.7833', 'lon' => '-108.5007', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'billings', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'binghamton' => array( 'name' => 'Binghamton', 'city' => 'binghamton', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.0987', 'lon' => '-75.9180', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'binghamton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'birmingham' => array( 'name' => 'Birmingham', 'city' => 'birmingham', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '33.5250', 'lon' => '86.8130', 'background-class' => 'general-panel', 'background_class' => 'general-panel', 'key_value' => 'birmingham', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bismarck' => array( 'name' => 'Bismarck', 'city' => 'bismarck', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.9812', 'lon' => '-100.7003', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bismarck', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bloomington' => array( 'name' => 'Bloomington', 'city' => 'bloomington', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.1653', 'lon' => '-86.5264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bloomington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bloomington-normal' => array( 'name' => 'Bloomington–Normal', 'city' => 'bloomington-normal', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4842', 'lon' => '-88.9937', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bloomington-normal', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boise' => array( 'name' => 'Boise', 'city' => 'Boise', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.6167', 'lon' => '-116.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boise', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boone' => array( 'name' => 'Boone', 'city' => 'boone', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.2114', 'lon' => '-81.6686', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boone', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boston' => array( 'name' => 'Boston', 'city' => 'Boston', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '42.3581', 'lon' => '-71.0389', 'background-class' => 'boston-panel', 'background_class' => 'boston-panel', 'key_value' => 'boston', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'boulder' => array( 'name' => 'Boulder', 'city' => 'boulder', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.0274', 'lon' => '-105.2519', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boulder', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bowling green' => array( 'name' => 'Bowling Green', 'city' => 'bowling green', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.9685', 'lon' => '-86.4808', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bowling green', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bozeman' => array( 'name' => 'Bozeman', 'city' => 'bozeman', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '45.6770', 'lon' => '-111.0429', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bozeman', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brainerd' => array( 'name' => 'Brainerd', 'city' => 'brainerd', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.3527', 'lon' => '-94.2020', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brainerd', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brownsville' => array( 'name' => 'Brownsville', 'city' => 'brownsville', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '25.9017', 'lon' => '-97.4975', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brownsville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brunswick' => array( 'name' => 'Brunswick', 'city' => 'brunswick', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.1500', 'lon' => '-81.4915', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brunswick', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'buffalo' => array( 'name' => 'Buffalo', 'city' => 'Buffalo', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.9047', 'lon' => '-78.8494', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'buffalo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'butte' => array( 'name' => 'Butte', 'city' => 'butte', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.0038', 'lon' => '-112.5348', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'butte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cape cod / islands' => array( 'name' => 'Cape Cod / Islands', 'city' => 'cape cod / islands', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6800', 'lon' => '-70.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cape cod / islands', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'catskills' => array( 'name' => 'Catskills', 'city' => 'catskills', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2146', 'lon' => '-73.9595', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'catskills', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cedar rapids' => array( 'name' => 'Cedar Rapids', 'city' => 'cedar rapids', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.9779', 'lon' => '-91.6656', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cedar rapids', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central louisiana' => array( 'name' => 'Central Louisiana', 'city' => 'central louisiana', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.5543', 'lon' => '-91.0369', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central louisiana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central michigan' => array( 'name' => 'Central Michigan', 'city' => 'central michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4071', 'lon' => '-88.2007', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central NJ' => array( 'name' => 'Central NJ', 'city' => 'New Brunswick', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.2237', 'lon' => '-74.7640', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central NJ', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'champaign urbana' => array( 'name' => 'Champaign Urbana', 'city' => 'champaign urbana', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1164', 'lon' => '-88.2434', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'champaign urbana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charleston' => array( 'name' => 'Charleston', 'city' => 'charleston', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.3498', 'lon' => '-81.6326', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charleston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charlotte' => array( 'name' => 'Charlotte', 'city' => 'charlotte', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '35.2269', 'lon' => '-80.8433', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charlotte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charlottesville' => array( 'name' => 'Charlottesville', 'city' => 'charlottesville', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.0293', 'lon' => '-38.0293', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charlottesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chattanooga' => array( 'name' => 'Chattanooga', 'city' => 'chattanooga', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.0456', 'lon' => '-84.2672', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chattanooga', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chautauqua' => array( 'name' => 'Chautauqua', 'city' => 'chautauqua', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2098', 'lon' => '-79.4668', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chautauqua', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chicago' => array( 'name' => 'Chicago', 'city' => 'Chicago', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '41.8781', 'lon' => '-87.6298', 'background-class' => 'chicago-panel', 'background_class' => 'chicago-panel', 'key_value' => 'chicago', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'chico' => array( 'name' => 'Chico', 'city' => 'chico', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.7285', 'lon' => '-121.8375', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chico', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chillicothe' => array( 'name' => 'Chillicothe ', 'city' => 'chillicothe', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3331', 'lon' => '-82.9824', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chillicothe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cincinnati' => array( 'name' => 'Cincinnati', 'city' => 'Cincinnati', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.1000', 'lon' => '-84.5167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cincinnati', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'clarksville' => array( 'name' => 'Clarksville', 'city' => 'clarksville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.5298', 'lon' => '-87.3595', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'clarksville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cleveland' => array( 'name' => 'Cleveland', 'city' => 'Cleveland', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.4822', 'lon' => '-81.6697', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cleveland', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'clovis / portales' => array( 'name' => 'Clovis / Portales', 'city' => 'clovis / portales', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.1862', 'lon' => '-103.3344', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'clovis / portales', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'college station' => array( 'name' => 'College Station', 'city' => 'college station', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.6014', 'lon' => '-96.3144', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'college station', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'colorado springs' => array( 'name' => 'Colorado Springs', 'city' => 'Colorado Springs', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.8673', 'lon' => '-104.7607', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'colorado springs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbia' => array( 'name' => 'Columbia', 'city' => 'columbia', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.0298', 'lon' => '-80.8966', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbia', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbia / jeff city' => array( 'name' => 'columbia / jeff city', 'city' => 'columbia / jeff city', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.9517', 'lon' => '-92.3341', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbia / jeff city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbus' => array( 'name' => 'Columbus GA', 'city' => 'columbus', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.4610', 'lon' => '-84.9877', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbus', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cookeville' => array( 'name' => 'Cookeville', 'city' => 'cookeville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.1628', 'lon' => '-85.5016', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cookeville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'corpus christi' => array( 'name' => 'Corpus Christi', 'city' => 'Corpus Christi', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '27.7428', 'lon' => '-97.4019', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'corpus christi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'corvallis/albany' => array( 'name' => 'Corvallis/Albany', 'city' => 'corvallis/albany', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.9559', 'lon' => '-123.0170', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'corvallis/albany', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cumberland valley' => array( 'name' => 'Cumberland Valley', 'city' => 'cumberland valley', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1300', 'lon' => '-78.2405', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cumberland valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dallas / fort worth' => array( 'name' => 'Dallas / Fort Worth', 'city' => 'dallas / fort worth', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '32.7555', 'lon' => '-97.3308', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dallas / fort worth', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'danville' => array( 'name' => 'Danville', 'city' => 'danville', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.5860', 'lon' => '-79.3950', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'danville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dayton / springfield' => array( 'name' => 'Dayton / Springfield', 'city' => 'dayton / springfield', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '39.7594', 'lon' => '-84.1917', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dayton / springfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'daytona beach' => array( 'name' => 'Daytona Beach', 'city' => 'daytona beach', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.1900', 'lon' => '-81.0894', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'daytona beach', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'decatur' => array( 'name' => 'Decatur', 'city' => 'decatur', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.8403', 'lon' => '-88.9548', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'decatur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'deep east texas' => array( 'name' => 'Deep East Texas', 'city' => 'deep east texas', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5263', 'lon' => '-94.0812', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'deep east texas', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'del rio / eagle pass' => array( 'name' => 'Del Rio / Eagle Pass', 'city' => 'del rio / eagle pass', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.7091', 'lon' => '-100.4995', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'del rio / eagle pass', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'delaware' => array( 'name' => 'Delaware', 'city' => 'delaware', 'state' => 'DE', 'state_expanded' => 'Delaware', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.0000', 'lon' => '-75.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'delaware', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'denver' => array( 'name' => 'Denver', 'city' => 'denver', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '39.7376', 'lon' => '-104.9847', 'background-class' => 'denver-panel', 'background_class' => 'denver-panel', 'key_value' => 'denver', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'des moines' => array( 'name' => 'Des Moines', 'city' => 'des moines', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.5908', 'lon' => '-93.6208', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'des moines', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'detroit metro' => array( 'name' => 'Detroit Metro', 'city' => 'detroit metro', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '42.2162', 'lon' => '-83.3554', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'detroit metro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dothan' => array( 'name' => 'Dothan', 'city' => 'dothan', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.2232', 'lon' => '85.3905', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dothan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dubuque' => array( 'name' => 'Dubuque', 'city' => 'dubuque', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.6958', 'lon' => '-98.6090', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dubuque', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'duluth / superior' => array( 'name' => 'Duluth / Superior', 'city' => 'duluth / superior', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.7860', 'lon' => '-92.1005', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'duluth / superior', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'east idaho' => array( 'name' => 'East Idaho', 'city' => 'east idaho', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.4916', 'lon' => '-112.0340', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'east idaho', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'east oregon' => array( 'name' => 'East Oregon', 'city' => 'east oregon', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.0266', 'lon' => '-116.9629', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'east oregon', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern CO' => array( 'name' => 'Eastern CO', 'city' => 'eastern CO', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.8605', 'lon' => '-104.7871', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern CO', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern CT' => array( 'name' => 'Eastern CT', 'city' => 'Hartford', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.0511', 'lon' => '-73.4792', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern CT', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern kentucky' => array( 'name' => 'Eastern Kentucky', 'city' => 'eastern kentucky', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.5165', 'lon' => '-82.8067', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern kentucky', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern NC' => array( 'name' => 'Eastern North Carolina', 'city' => 'eastern NC', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '34.6388', 'lon' => '-78.6374', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern NC', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern panhandle' => array( 'name' => 'Eastern Panhandle', 'city' => 'eastern panhandle', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4562', 'lon' => '-77.9639', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern shore' => array( 'name' => 'Eastern Shore', 'city' => 'eastern shore', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.2102', 'lon' => '-75.6848', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern shore', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eau claire' => array( 'name' => 'Eau Claire', 'city' => 'eau claire', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.8113', 'lon' => '-91.4985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eau claire', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'el paso' => array( 'name' => 'El Paso', 'city' => 'el paso', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '31.7903', 'lon' => '-106.4233', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'el paso', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'elko' => array( 'name' => 'Elko', 'city' => 'elko', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.8324', 'lon' => '-115.7631', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'elko', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'elmira-corning' => array( 'name' => 'Elmira-Corning', 'city' => 'elmira-corning', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0898', 'lon' => '-76.8077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'elmira-corning', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'erie' => array( 'name' => 'Erie', 'city' => 'erie', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.1292', 'lon' => '-80.0851', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'erie', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eugene' => array( 'name' => 'Eugene', 'city' => 'eugene', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.0519', 'lon' => '-123.0867', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eugene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'evansville' => array( 'name' => 'Evansville', 'city' => 'evansville', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.9716', 'lon' => '-87.5710', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'evansville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fairbanks' => array( 'name' => 'Fairbanks', 'city' => 'fairbanks', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '64.8378', 'lon' => '147.7164', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fairbanks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new york city' => array( 'name' => 'New York City', 'city' => 'new york city', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '40.7128', 'lon' => '-74.0060', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new york city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fargo / moorhead' => array( 'name' => 'Fargo / Moorhead', 'city' => 'fargo / moorhead', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.8772', 'lon' => '-96.7898', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fargo / moorhead', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'farmington' => array( 'name' => 'Farmington', 'city' => 'farmington', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.7281', 'lon' => '-108.2187', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'farmington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fayetteville AR' => array( 'name' => 'Fayetteville AR', 'city' => 'fayetteville AR', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0764', 'lon' => '-94.1608', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fayetteville AR', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fayetteville NC' => array( 'name' => 'Fayetteville NC', 'city' => 'fayetteville NC', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.0525', 'lon' => '-78.8781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fayetteville NC', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'finger lakes' => array( 'name' => 'Finger Lakes', 'city' => 'finger lakes', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.7238', 'lon' => '-76.9297', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'finger lakes', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'flagstaff / sedona' => array( 'name' => 'Flagstaff / Sedona', 'city' => 'flagstaff / sedona', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.1983', 'lon' => '111.6513', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'flagstaff / sedona', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'flint' => array( 'name' => 'Flint', 'city' => 'flint', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '43.0125', 'lon' => '-83.6875', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'flint', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florence' => array( 'name' => 'Florence', 'city' => 'florence', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.3803', 'lon' => '-79.0753', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florence', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florence / muscle shoals' => array( 'name' => 'Florence / Muscle Shoals', 'city' => 'florence / muscle shoals', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.7998', 'lon' => '87.6773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florence / muscle shoals', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florida keys' => array( 'name' => 'Florida Keys', 'city' => 'florida keys', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '0', 'cl_posting_fee' => '10', 'lat' => '25.0865', 'lon' => '-80.4473', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florida keys', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort collins / north CO' => array( 'name' => 'Fort Collins / North CO', 'city' => 'fort collins / north CO', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.5592', 'lon' => '-105.0781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort collins / north CO', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort dodge' => array( 'name' => 'Fort Dodge', 'city' => 'fort dodge', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4975', 'lon' => '-94.1680', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort dodge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort smith' => array( 'name' => 'Fort Smith', 'city' => 'fort smith', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.3859', 'lon' => '94.3985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort smith', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort wayne' => array( 'name' => 'Fort Wayne', 'city' => 'fort wayne', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.0804', 'lon' => '-85.1392', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort wayne', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'frederick' => array( 'name' => 'Frederick', 'city' => 'frederick', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.4140', 'lon' => '-77.4105', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'frederick', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fredericksburg' => array( 'name' => 'Fredericksburg', 'city' => 'fredericksburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.3032', 'lon' => '-77.4605', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fredericksburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fresno / madera' => array( 'name' => 'Fresno / Madera', 'city' => 'Fresno', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.7500', 'lon' => '-119.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fresno / madera', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ft myers / SW florida' => array( 'name' => 'Ft Myers / SW Florida', 'city' => 'ft myers / SW florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '26.6167', 'lon' => '-81.8333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ft myers / SW florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gadsden-anniston' => array( 'name' => 'Gadsden-Anniston', 'city' => 'gadsden-anniston', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.6598', 'lon' => '85.8316', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gadsden-anniston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gainesville' => array( 'name' => 'Gainesville', 'city' => 'gainesville', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.6520', 'lon' => '-82.3250', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gainesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'galveston' => array( 'name' => 'Galveston ', 'city' => 'galveston', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.2811', 'lon' => '-94.8258', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'galveston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'glens falls' => array( 'name' => 'Glens Falls', 'city' => 'glens falls', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.3095', 'lon' => '-73.6440', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'glens falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gold country' => array( 'name' => 'Gold Country', 'city' => 'gold country', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.6263', 'lon' => '-121.2466', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gold country', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand forks' => array( 'name' => 'Grand Forks', 'city' => 'grand forks', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.9253', 'lon' => '-97.0329', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand forks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand island' => array( 'name' => 'Grand Island', 'city' => 'grand island', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.9264', 'lon' => '-98.3420', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand rapids' => array( 'name' => 'Grand Rapids', 'city' => 'Grand Rapids', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.9612', 'lon' => '-85.6557', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand rapids', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'great falls' => array( 'name' => 'Great Falls', 'city' => 'great falls', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.5053', 'lon' => '-111.3008', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'great falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'green bay' => array( 'name' => 'Green Bay', 'city' => 'green bay', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.5133', 'lon' => '-88.0158', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'green bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'greensboro' => array( 'name' => 'Greensboro', 'city' => 'greensboro', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0800', 'lon' => '-79.8194', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'greensboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'greenville / upstate' => array( 'name' => 'Greenville / Upstate', 'city' => 'Greenville', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '34.8444', 'lon' => '-82.3856', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'greenville / upstate', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gulfport / biloxi' => array( 'name' => 'Gulfport / Biloxi', 'city' => 'gulfport / biloxi', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.3674', 'lon' => '-89.0928', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gulfport / biloxi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hampton roads' => array( 'name' => 'Hampton Roads', 'city' => 'Hampton Roads', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.9667', 'lon' => '-76.3667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hampton roads', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hanford-corcoran' => array( 'name' => 'Hanford-Corcoran', 'city' => 'hanford-corcoran', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.0988', 'lon' => '-119.8815', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hanford-corcoran', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'harrisburg' => array( 'name' => 'Harrisburg', 'city' => 'harrisburg', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.2697', 'lon' => '-76.8756', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'harrisburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'harrisonburg' => array( 'name' => 'Harrisonburg', 'city' => 'harrisonburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.4496', 'lon' => '-78.8689', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'harrisonburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hartford' => array( 'name' => 'Hartford', 'city' => 'Hartford', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.7627', 'lon' => '-72.6743', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hartford', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hattiesburg' => array( 'name' => 'Hattiesburg', 'city' => 'hattiesburg', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.3271', 'lon' => '-89.2903', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hattiesburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hawaii' => array( 'name' => 'Hawaii', 'city' => 'hawaii', 'state' => 'HI', 'state_expanded' => 'Hawaii', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '21.3114', 'lon' => '-157.7964', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hawaii', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'heartland florida' => array( 'name' => 'Heartland Florida', 'city' => 'heartland florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '27.2142', 'lon' => '-81.7787', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'heartland florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'helena' => array( 'name' => 'Helena', 'city' => 'helena', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.5891', 'lon' => '-112.0391', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'helena', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hickory / lenoir' => array( 'name' => 'Hickory / Lenoir', 'city' => 'hickory / lenoir', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.7345', 'lon' => '-81.3445', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hickory / lenoir', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'high rockies' => array( 'name' => 'High Rockies', 'city' => 'high rockies', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.2234', 'lon' => '-105.9955', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'high rockies', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hilton head' => array( 'name' => 'Hilton Head Island', 'city' => 'hilton head', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.2163', 'lon' => '-80.7526', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hilton head', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'holland' => array( 'name' => 'Holland', 'city' => 'holland', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.7875', 'lon' => '-86.1089', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'holland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'Holyoke' => array( 'name' => 'Holyoke', 'city' => 'Holyoke', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '42.2042', 'lon' => '-72.6167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'Holyoke', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'houma' => array( 'name' => 'Houma', 'city' => 'houma', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.5958', 'lon' => '-90.7195', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'houma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'houston' => array( 'name' => 'Houston', 'city' => 'Houston', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '29.7602', 'lon' => '-95.3694', 'background-class' => 'houston-panel', 'background_class' => 'houston-panel', 'key_value' => 'houston', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'hudson valley' => array( 'name' => 'Hudson Valley', 'city' => 'Hudson Valley', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.1500', 'lon' => '-73.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hudson valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'humboldt county' => array( 'name' => 'Humboldt County', 'city' => 'humboldt county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.7450', 'lon' => '-123.8690', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'humboldt county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'huntsville / decatur' => array( 'name' => 'Huntsville / Decatur', 'city' => 'huntsville / decatur', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.5810', 'lon' => '-86.9834', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'huntsville / decatur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'imperial county' => array( 'name' => 'Imperial County', 'city' => 'imperial county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.0114', 'lon' => '-115.4734', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'imperial county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'indianapolis' => array( 'name' => 'Indianapolis', 'city' => 'Indianapolis', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.7910', 'lon' => '-86.1480', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'indianapolis', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'inland empire' => array( 'name' => 'Inland Empire', 'city' => 'Inland Empire', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '34.1216', 'lon' => '-116.9300', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'inland empire', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'iowa city' => array( 'name' => 'Iowa City', 'city' => 'iowa city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.6611', 'lon' => '-91.5302', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'iowa city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ithaca' => array( 'name' => 'Ithaca', 'city' => 'ithaca', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4440', 'lon' => '-76.5019', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ithaca', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jackson' => array( 'name' => 'Jackson', 'city' => 'jackson', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.6145', 'lon' => '-88.8139', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jackson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jacksonville' => array( 'name' => 'Jacksonville NC', 'city' => 'jacksonville', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.7541', 'lon' => '-77.4302', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jacksonville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'janesville' => array( 'name' => 'Janesville', 'city' => 'janesville', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.6839', 'lon' => '-89.0164', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'janesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jersey shore' => array( 'name' => 'Jersey Shore', 'city' => 'Jersey Shore', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.2025', 'lon' => '-77.2667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jersey shore', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jonesboro' => array( 'name' => 'Jonesboro', 'city' => 'jonesboro', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.8423', 'lon' => '90.7043', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jonesboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'joplin' => array( 'name' => 'Joplin', 'city' => 'joplin', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.0842', 'lon' => '-94.5133', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'joplin', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kalamazoo' => array( 'name' => 'Kalamazoo', 'city' => 'kalamazoo', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.2900', 'lon' => '-85.5858', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kalamazoo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kalispell' => array( 'name' => 'Kalispell', 'city' => 'kalispell', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '48.1920', 'lon' => '-114.3168', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kalispell', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kansas city' => array( 'name' => 'Kansas City MO', 'city' => 'kansas city', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.0997', 'lon' => '-94.5786', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kansas city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kenai peninsula' => array( 'name' => 'Kenai Peninsula Borough', 'city' => 'kenai peninsula', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '60.0858', 'lon' => '151.3823', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kenai peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kennewick-pasco-richland' => array( 'name' => 'Kennewick-Pasco-Richland', 'city' => 'kennewick-pasco-richland', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.2087', 'lon' => '-119.1199', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kennewick-pasco-richland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kenosha-racine' => array( 'name' => 'Kenosha-Racine', 'city' => 'kenosha-racine', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.5881', 'lon' => '-87.8229', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kenosha-racine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'killeen / temple / ft hood' => array( 'name' => 'Temple / Kileen / Ft Hood', 'city' => 'Temple', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '31.0936', 'lon' => '-97.3622', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'killeen / temple / ft hood', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'kirksville' => array( 'name' => 'Kirksville', 'city' => 'kirksville', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1948', 'lon' => '-92.5832', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kirksville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'klamath falls' => array( 'name' => 'Klamath Falls', 'city' => 'klamath falls', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2249', 'lon' => '-121.7817', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'klamath falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'knoxville' => array( 'name' => 'Knoxville', 'city' => 'Knoxville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.9728', 'lon' => '-83.9422', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'knoxville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kokomo' => array( 'name' => 'Kokomo', 'city' => 'kokomo', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4864', 'lon' => '-86.1336', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kokomo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'la crosse' => array( 'name' => 'La Crosse', 'city' => 'la crosse', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '43.8138', 'lon' => '-91.2519', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'la crosse', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'la salle co' => array( 'name' => 'La Salle Co', 'city' => 'la salle co', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.3622', 'lon' => '-89.0418', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'la salle co', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lafayette' => array( 'name' => 'Lafayette', 'city' => 'lafayette', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.2241', 'lon' => '-92.0198', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lafayette', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lafayette / west lafayette' => array( 'name' => 'Lafayette / West Lafayette', 'city' => 'lafayette / west lafayette', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4259', 'lon' => '-86.9081', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lafayette / west lafayette', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lake charles' => array( 'name' => 'Lake Charles', 'city' => 'lake charles', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.2266', 'lon' => '-93.2174', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lake charles', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lake of the ozarks' => array( 'name' => 'Lake Of The Ozarks', 'city' => 'lake of the ozarks', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.1380', 'lon' => '-92.8104', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lake of the ozarks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lakeland' => array( 'name' => 'Lakeland', 'city' => 'lakeland', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '28.0411', 'lon' => '-81.9589', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lakeland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lancaster' => array( 'name' => 'Lancaster', 'city' => 'lancaster', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.0397', 'lon' => '-76.3044', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lancaster', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lansing' => array( 'name' => 'Lansing', 'city' => 'lansing', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.7336', 'lon' => '-84.5467', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lansing', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'laredo' => array( 'name' => 'Laredo', 'city' => 'laredo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '27.5036', 'lon' => '-99.5076', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'laredo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'las cruces' => array( 'name' => 'Las Cruces', 'city' => 'las cruces', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3199', 'lon' => '-106.7637', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'las cruces', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'las vegas' => array( 'name' => 'Las Vegas', 'city' => 'Las Vegas', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '36.1699', 'lon' => '-115.1398', 'background-class' => 'lasvegas-panel', 'background_class' => 'lasvegas-panel', 'key_value' => 'las vegas', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'lawrence' => array( 'name' => 'Lawrence', 'city' => 'lawrence', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.9717', 'lon' => '-95.2353', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lawrence', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lawton' => array( 'name' => 'Lawton', 'city' => 'lawton', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.6036', 'lon' => '-98.3959', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lawton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lehigh valley' => array( 'name' => 'Lehigh Valley', 'city' => 'lehigh valley', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.6017', 'lon' => '-75.4772', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lehigh valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lewiston / clarkston' => array( 'name' => 'Lewiston / Clarkston', 'city' => 'lewiston / clarkston', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.4004', 'lon' => '-117.0012', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lewiston / clarkston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lexington' => array( 'name' => 'Lexington', 'city' => 'lexington', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '38.0297', 'lon' => '-84.4947', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lexington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lima / findlay' => array( 'name' => 'Lima / Findlay', 'city' => 'lima / findlay', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.7426', 'lon' => '-84.1052', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lima / findlay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lincoln' => array( 'name' => 'Lincoln', 'city' => 'Lincoln', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.8106', 'lon' => '-96.6803', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lincoln', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'little rock' => array( 'name' => 'Little Rock', 'city' => 'little rock', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.7361', 'lon' => '-92.3311', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'little rock', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'logan' => array( 'name' => 'Logan', 'city' => 'logan', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.7378', 'lon' => '-111.8308', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'logan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'long island' => array( 'name' => 'Long Island', 'city' => 'long island', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.7891', 'lon' => '-73.1350', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'long island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'los angeles' => array( 'name' => 'Los Angeles', 'city' => 'Los Angeles', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '34.0522', 'lon' => '-118.2437', 'background-class' => 'la-panel', 'background_class' => 'la-panel', 'key_value' => 'los angeles', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'louisville' => array( 'name' => 'Louisville', 'city' => 'Louisville', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.2500', 'lon' => '-85.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'louisville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lubbock' => array( 'name' => 'Lubbock', 'city' => 'lubbock', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '33.5667', 'lon' => '-101.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lubbock', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lynchburg' => array( 'name' => 'Lynchburg', 'city' => 'lynchburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.4138', 'lon' => '-79.1422', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lynchburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'macon / warner robins' => array( 'name' => 'Macon / Warner Robins', 'city' => 'macon / warner robins', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.8407', 'lon' => '-83.6324', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'macon / warner robins', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'madison' => array( 'name' => 'Madison', 'city' => 'Madison', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.0667', 'lon' => '-89.4000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'madison', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'maine' => array( 'name' => 'Maine', 'city' => 'Maine', 'state' => 'ME', 'state_expanded' => 'Maine', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '45.5000', 'lon' => '-69.0000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'maine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'manhattan' => array( 'name' => 'Manhattan', 'city' => 'manhattan', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.1836', 'lon' => '-96.5717', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'manhattan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mankato' => array( 'name' => 'Mankato', 'city' => 'mankato', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.1636', 'lon' => '-93.9994', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mankato', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mansfield' => array( 'name' => 'Mansfield', 'city' => 'mansfield', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.7584', 'lon' => '-82.5154', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mansfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mason city' => array( 'name' => 'Mason City', 'city' => 'mason city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '143.1536', 'lon' => '-93.2010', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mason city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mattoon-charleston' => array( 'name' => 'Mattoon-Charleston', 'city' => 'mattoon-charleston', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4961', 'lon' => '-88.1762', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mattoon-charleston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mcallen / edinburg' => array( 'name' => 'McAllen / Edinburg', 'city' => 'mcallen / edinburg', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '26.2164', 'lon' => '-98.2364', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mcallen / edinburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'meadville' => array( 'name' => 'Meadville', 'city' => 'meadville', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.6414', 'lon' => '80.1514', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'meadville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'medford-ashland' => array( 'name' => 'Medford-Ashland', 'city' => 'medford-ashland', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.1946', 'lon' => '-122.7095', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'medford-ashland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'memphis' => array( 'name' => 'Memphis', 'city' => 'Memphis', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.1174', 'lon' => '-89.9711', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'memphis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mendocino county' => array( 'name' => 'Mendocino County', 'city' => 'mendocino county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.5500', 'lon' => '-123.4384', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mendocino county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'merced' => array( 'name' => 'Merced', 'city' => 'merced', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.3022', 'lon' => '-120.4830', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'merced', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'meridian' => array( 'name' => 'Meridian', 'city' => 'meridian', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3643', 'lon' => '-88.7037', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'meridian', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'miami' => array( 'name' => 'Miami', 'city' => 'Miami', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '25.7891', 'lon' => '-80.2040', 'background-class' => 'miami-panel', 'background_class' => 'miami-panel', 'key_value' => 'miami', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'milwaukee' => array( 'name' => 'Milwaukee', 'city' => 'Milwaukee', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.0500', 'lon' => '87.9500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'milwaukee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'minneapolis' => array( 'name' => 'Minneapolis / St. Paul', 'city' => 'minneapolis', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '44.9778', 'lon' => '-93.2650', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'minneapolis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'missoula' => array( 'name' => 'Missoula', 'city' => 'missoula', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.8721', 'lon' => '-113.9940', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'missoula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mobile' => array( 'name' => 'Mobile', 'city' => 'Mobile', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.6944', 'lon' => '88.0431', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mobile', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'modesto' => array( 'name' => 'Modesto', 'city' => 'modesto', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.6614', 'lon' => '-120.9944', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'modesto', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mohave county' => array( 'name' => 'Mohave County', 'city' => 'mohave county', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.2143', 'lon' => '113.7633', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mohave county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'monroe' => array( 'name' => 'Monroe MI', 'city' => 'monroe', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.9164', 'lon' => '-83.3977', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'monroe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'monterey bay' => array( 'name' => 'Monterey Bay', 'city' => 'monterey bay', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.8000', 'lon' => '-121.9000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'monterey bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'montgomery' => array( 'name' => 'Montgomery', 'city' => 'montgomery', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3792', 'lon' => '86.3077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'montgomery', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'morgantown' => array( 'name' => 'Morgantown', 'city' => 'morgantown', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.6336', 'lon' => '-79.9506', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'morgantown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'moses lake' => array( 'name' => 'Moses Lake', 'city' => 'moses lake', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.1301', 'lon' => '-119.2781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'moses lake', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'muncie / anderson' => array( 'name' => 'Muncie / Anderson', 'city' => 'muncie / anderson', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1934', 'lon' => '-85.3864', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'muncie / anderson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'muskegon' => array( 'name' => 'Muskegon', 'city' => 'muskegon', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2342', 'lon' => '-86.2484', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'muskegon', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'myrtle beach' => array( 'name' => 'Myrtle Beach', 'city' => 'myrtle beach', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '33.7167', 'lon' => '-78.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'myrtle beach', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'nashville' => array( 'name' => 'Nashville', 'city' => 'nashville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '36.1667', 'lon' => '-86.7833', 'background-class' => 'nashville-panel', 'background_class' => 'nashville-panel', 'key_value' => 'nashville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest MS' => array( 'name' => 'Natchez', 'city' => 'southwest MS', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5604', 'lon' => '-91.4032', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest MS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new hampshire' => array( 'name' => 'New Hampshire', 'city' => 'Waterville Valley', 'state' => 'NH', 'state_expanded' => 'New Hampshire', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '44.0000', 'lon' => '-71.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new hampshire', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'new haven' => array( 'name' => 'New Haven ', 'city' => 'New Haven ', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.3100', 'lon' => '-72.9236', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new haven', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new orleans' => array( 'name' => 'New Orleans', 'city' => 'New Orleans', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '29.9500', 'lon' => '-90.0667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new orleans', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new river valley' => array( 'name' => 'New River Valley', 'city' => 'new river valley', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.1384', 'lon' => '-80.6812', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new river valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north central FL' => array( 'name' => 'North Central FL', 'city' => 'north central FL', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.5383', 'lon' => '-81.3792', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north central FL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north dakota' => array( 'name' => 'North Dakota', 'city' => 'north dakota', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.5515', 'lon' => '-101.0020', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north dakota', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north jersey' => array( 'name' => 'North Jersey', 'city' => 'North Jersey', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '40.7915', 'lon' => '-74.2624', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north jersey', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north mississippi' => array( 'name' => 'North Mississippi', 'city' => 'north mississippi', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3547', 'lon' => '-89.3985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north mississippi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north platte' => array( 'name' => 'North Platte', 'city' => 'north platte', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.1403', 'lon' => '-100.7601', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north platte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northeast SD' => array( 'name' => 'Northeast SD', 'city' => 'northeast SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.8711', 'lon' => '-97.3973', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northeast SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern michigan' => array( 'name' => 'Northern Michigan', 'city' => 'northern michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.5596', 'lon' => '-87.4045', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern panhandle' => array( 'name' => 'Northern Panhandle', 'city' => 'northern panhandle', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.0640', 'lon' => '-80.7209', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern WI' => array( 'name' => 'Northern WI', 'city' => 'northern WI', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '45.8077', 'lon' => '-89.7251', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern WI', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest CT' => array( 'name' => 'Northwest CT', 'city' => 'northwest CT', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8253', 'lon' => '-73.1016', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest CT', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest GA' => array( 'name' => 'Northwest GA', 'city' => 'northwest GA', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.1661', 'lon' => '-84.8006', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest GA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest KS' => array( 'name' => 'Northwest KS', 'city' => 'northwest KS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3992', 'lon' => '-101.0464', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest OK' => array( 'name' => 'Northwest OK', 'city' => 'northwest OK', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.9420', 'lon' => '-95.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest OK', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ocala' => array( 'name' => 'Ocala', 'city' => 'ocala', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.1878', 'lon' => '-82.1306', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ocala', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'odessa' => array( 'name' => 'Odessa / Midland', 'city' => 'odessa / midland', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '31.8633', 'lon' => '-102.3656', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'odessa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ogden-clearfield' => array( 'name' => 'Ogden–Clearfield', 'city' => 'ogden-clearfield', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.1645', 'lon' => '-112.0476', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ogden-clearfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'okaloosa / walton' => array( 'name' => 'Okaloosa / Walton', 'city' => 'okaloosa / walton', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.4201', 'lon' => '-86.6170', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'okaloosa / walton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'oklahoma city' => array( 'name' => 'Oklahoma City', 'city' => 'Oklahoma City', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.4822', 'lon' => '-97.5350', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oklahoma city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'olympic peninsula' => array( 'name' => 'Olympic Peninsula', 'city' => 'olympic peninsula', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.8021', 'lon' => '-123.6044', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'olympic peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'omaha / council bluffs' => array( 'name' => 'Omaha / Council bluffs', 'city' => 'Omaha', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.2500', 'lon' => '-96.0000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'omaha / council bluffs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'oneonta' => array( 'name' => 'Oneonta', 'city' => 'oneonta', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4529', 'lon' => '-75.0638', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oneonta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'orange county' => array( 'name' => 'Orange County', 'city' => 'Irvine', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '33.7175', 'lon' => '-117.8311', 'background-class' => 'orangecounty-panel', 'background_class' => 'orangecounty-panel', 'key_value' => 'orange county', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'oregon coast' => array( 'name' => 'Oregon Coast', 'city' => 'oregon coast', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.1871', 'lon' => '-124.1146', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oregon coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'orlando' => array( 'name' => 'Orlando', 'city' => 'orlando', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '28.4158', 'lon' => '-81.2989', 'background-class' => 'orlando-panel', 'background_class' => 'orlando-panel', 'key_value' => 'orlando', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast IA' => array( 'name' => 'Ottumwa', 'city' => 'southeast IA', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.0160', 'lon' => '-92.4083', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast IA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'outer banks' => array( 'name' => 'Outer Banks', 'city' => 'outer banks', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.5585', 'lon' => '-75.4665', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'outer banks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'owensboro' => array( 'name' => 'Owensboro', 'city' => 'owensboro', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.7719', 'lon' => '-87.1112', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'owensboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'palm springs' => array( 'name' => 'Palm Springs', 'city' => 'Palm Springs', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '33.8303', 'lon' => '-116.5453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'palm springs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'panama city' => array( 'name' => 'Panama City', 'city' => 'panama city', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.1588', 'lon' => '-85.6602', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'panama city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'parkersburg-marietta' => array( 'name' => 'Parkersburg-Marietta', 'city' => 'parkersburg-marietta', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.2821', 'lon' => '-81.5377', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'parkersburg-marietta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pensacola' => array( 'name' => 'Pensacola', 'city' => 'pensacola', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '30.4333', 'lon' => '-87.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pensacola', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'peoria' => array( 'name' => 'Peoria', 'city' => 'peoria', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.6936', 'lon' => '-89.5890', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'peoria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'philadelphia' => array( 'name' => 'Philadelphia', 'city' => 'Philadelphia', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '39.9523', 'lon' => '-75.1638', 'background-class' => 'philadelphia-panel', 'background_class' => 'philadelphia-panel', 'key_value' => 'philadelphia', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'phoenix' => array( 'name' => 'Phoenix', 'city' => 'phoenix', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '33.4484', 'lon' => '-112.0740', 'background-class' => 'phoenix-panel', 'background_class' => 'phoenix-panel', 'key_value' => 'phoenix', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pierre / central SD' => array( 'name' => 'Pierre / Central SD', 'city' => 'pierre / central SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.3668', 'lon' => '-100.3538', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pierre / central SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pittsburgh' => array( 'name' => 'Pittsburgh', 'city' => 'Pittsburgh', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.4397', 'lon' => '-79.9764', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pittsburgh', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'plantsville' => array( 'name' => 'Plantsville', 'city' => 'Plantsville', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '41.5906', 'lon' => '-72.8931', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'plantsville', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'plattsburgh-adirondacks' => array( 'name' => 'Plattsburgh-Adirondacks', 'city' => 'plattsburgh-adirondacks', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.6995', 'lon' => '-73.4529', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'plattsburgh-adirondacks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'poconos' => array( 'name' => 'Poconos', 'city' => 'poconos', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.0700', 'lon' => '-75.4345', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'poconos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'port huron' => array( 'name' => 'Port Huron', 'city' => 'port huron', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.9709', 'lon' => '-82.4249', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'port huron', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'portland' => array( 'name' => 'Portland', 'city' => 'portland', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '45.5235', 'lon' => '-122.6762', 'background-class' => 'portland-panel', 'background_class' => 'portland-panel', 'key_value' => 'portland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'potsdam-canton-massena' => array( 'name' => 'Potsdam-Canton-Massena', 'city' => 'potsdam-canton-massena', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.9281', 'lon' => '-74.8919', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'potsdam-canton-massena', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'prescott' => array( 'name' => 'Prescott', 'city' => 'prescott', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.5400', 'lon' => '-112.4685', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'prescott', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'provo / orem' => array( 'name' => 'Provo / Orem', 'city' => 'provo / orem', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '0', 'cl_posting_fee' => '10', 'lat' => '40.2444', 'lon' => '-111.6608', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'provo / orem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pueblo' => array( 'name' => 'Pueblo', 'city' => 'pueblo', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.2544', 'lon' => '-104.6091', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pueblo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pullman / moscow' => array( 'name' => 'Pullman / Moscow', 'city' => 'pullman / moscow', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.7324', 'lon' => '-117.0002', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pullman / moscow', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'quad cities' => array( 'name' => 'Quad Cities', 'city' => 'quad cities', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.5236', 'lon' => '-90.5776', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'quad cities', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'raleigh / durham / CH' => array( 'name' => 'raleigh / durham / CH', 'city' => 'raleigh', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.7806', 'lon' => '-78.6389', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'raleigh / durham / CH', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rapid city / west SD' => array( 'name' => 'Rapid City / West SD', 'city' => 'rapid city / west SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.0805', 'lon' => '-103.2310', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rapid city / west SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'reading' => array( 'name' => 'Reading', 'city' => 'reading', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.3417', 'lon' => '-75.9264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'reading', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'redding' => array( 'name' => 'Redding', 'city' => 'redding', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.5865', 'lon' => '-122.3917', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'redding', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'reno / tahoe' => array( 'name' => 'Reno / Tahoe', 'city' => 'reno / tahoe', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.5272', 'lon' => '-119.8219', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'reno / tahoe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rhode island' => array( 'name' => 'Rhode Island', 'city' => 'Rhode Island', 'state' => 'RI', 'state_expanded' => 'Rhode Island', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.7000', 'lon' => '-71.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rhode island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'richmond' => array( 'name' => 'Richmond', 'city' => 'richmond', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.5407', 'lon' => '-77.4360', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'richmond', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roanoke' => array( 'name' => 'Roanoke', 'city' => 'roanoke', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.2710', 'lon' => '-79.9414', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roanoke', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rochester' => array( 'name' => 'Rochester MN', 'city' => 'rochester', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.0121', 'lon' => '-92.4802', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rochester', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rockford' => array( 'name' => 'Rockford', 'city' => 'rockford', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.2594', 'lon' => '-89.0644', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rockford', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roseburg' => array( 'name' => 'Roseburg', 'city' => 'roseburg', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2165', 'lon' => '-123.3417', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roseburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roswell / carlsbad' => array( 'name' => 'Roswell / Carlsbad', 'city' => 'roswell / carlsbad', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.3943', 'lon' => '-104.5230', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roswell / carlsbad', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sacramento' => array( 'name' => 'Sacramento', 'city' => 'Sacramento', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '38.5556', 'lon' => '-121.4689', 'background-class' => 'sacramento-panel', 'background_class' => 'sacramento-panel', 'key_value' => 'sacramento', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'saginaw-midland-baycity' => array( 'name' => 'Saginaw-Midland-Baycity', 'city' => 'saginaw-midland-baycity', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.5945', 'lon' => '-83.8889', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'saginaw-midland-baycity', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salem' => array( 'name' => 'Salem', 'city' => 'salem', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.9308', 'lon' => '-123.0289', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'salem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salina' => array( 'name' => 'Salina', 'city' => 'salina', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.8403', 'lon' => '-97.6114', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'salina', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salt lake city' => array( 'name' => 'Salt Lake City', 'city' => 'salt lake city', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.7500', 'lon' => '-111.8833', 'background-class' => 'saltlakecity-panel', 'background_class' => 'saltlakecity-panel', 'key_value' => 'salt lake city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san angelo' => array( 'name' => 'San Angelo', 'city' => 'san angelo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.4500', 'lon' => '-100.4500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san angelo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san antonio' => array( 'name' => 'San Antonio', 'city' => 'san antonio', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '29.4167', 'lon' => '-98.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san antonio', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san diego' => array( 'name' => 'San Diego', 'city' => 'San Diego', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '32.7157', 'lon' => '-117.1611', 'background-class' => 'sandiego-panel', 'background_class' => 'sandiego-panel', 'key_value' => 'san diego', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'san francisco bay area' => array( 'name' => 'San Francisco Bay Area', 'city' => 'San Francisco', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '75', 'lat' => '37.7771', 'lon' => '-122.4170', 'background-class' => 'sf-panel', 'background_class' => 'sf-panel', 'key_value' => 'san francisco bay area', 'pricing_plan_id' => '12', 'subscription_plan_id' => '8' ), 'san luis obispo' => array( 'name' => 'San Luis Obispo', 'city' => 'san luis obispo', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.2742', 'lon' => '120.6631', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san luis obispo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san marcos' => array( 'name' => 'San Marcos', 'city' => 'san marcos', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '29.8833', 'lon' => '-29.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san marcos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sandusky' => array( 'name' => 'Sandusky', 'city' => 'sandusky', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.4562', 'lon' => '-82.7117', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sandusky', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa barbara' => array( 'name' => 'Santa Barbara', 'city' => 'Santa Barbara', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '34.4258', 'lon' => '-119.7142', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa barbara', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa fe / taos' => array( 'name' => 'Santa Fe / Taos', 'city' => 'santa fe / taos', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.6870', 'lon' => '-105.9378', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa fe / taos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa maria' => array( 'name' => 'Santa Maria', 'city' => 'santa maria', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '34.9514', 'lon' => '-120.4333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa maria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sarasota-bradenton' => array( 'name' => 'Sarasota-Bradenton', 'city' => 'Sarasota', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '27.3372', 'lon' => '-82.5353', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sarasota-bradenton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'savannah / hinesville' => array( 'name' => 'Savannah / Hinesville', 'city' => 'savannah / hinesville', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '32.0167', 'lon' => '-81.1167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'savannah / hinesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'scottsbluff / panhandle' => array( 'name' => 'Scottsbluff / Panhandle', 'city' => 'scottsbluff / panhandle', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8666', 'lon' => '-103.6672', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'scottsbluff / panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'scranton / wilkes-barre' => array( 'name' => 'scranton / wilkes-barre', 'city' => 'scranton / wilkes-barre', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.4106', 'lon' => '-75.6675', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'scranton / wilkes-barre', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'seattle' => array( 'name' => 'Seattle-tacoma', 'city' => 'seattle', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '47.6062', 'lon' => '-122.3321', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'seattle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sheboygan' => array( 'name' => 'Sheboygan', 'city' => 'sheboygan', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.7508', 'lon' => '-87.7145', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sheboygan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'show low' => array( 'name' => 'Show Low', 'city' => 'show low', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.2542', 'lon' => '-110.0298', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'show low', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'shreveport' => array( 'name' => 'Shreveport', 'city' => 'shreveport', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.5252', 'lon' => '-93.7502', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'shreveport', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sierra vista' => array( 'name' => 'Sierra Vista', 'city' => 'sierra vista', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5455', 'lon' => '-110.2773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sierra vista', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sioux city' => array( 'name' => 'Sioux City', 'city' => 'sioux city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4963', 'lon' => '-96.4049', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sioux city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sioux falls / SE SD' => array( 'name' => 'Sioux Falls / SE SD', 'city' => 'sioux falls / SE SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.5473', 'lon' => '-96.7283', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sioux falls / SE SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'siskiyou county' => array( 'name' => 'Siskiyou County', 'city' => 'siskiyou county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.7743', 'lon' => '-122.5770', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'siskiyou county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'skagit' => array( 'name' => 'Skagit', 'city' => 'Concrete', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '48.4800', 'lon' => '-121.7800', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'skagit', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'skagit / island / SJI' => array( 'name' => 'Skagit / Island / SJI', 'city' => 'skagit / island / SJI', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '48.4242', 'lon' => '-121.7114', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'skagit / island / SJI', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south bend / michiana' => array( 'name' => 'South Bend / Michiana', 'city' => 'south bend / michiana', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6725', 'lon' => '-86.2553', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south bend / michiana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south coast' => array( 'name' => 'South Coast', 'city' => 'south coast', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6806', 'lon' => '-70.9083', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south dakota' => array( 'name' => 'South Dakota', 'city' => 'south dakota', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.9695', 'lon' => '-99.9018', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south dakota', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south florida' => array( 'name' => 'South Florida', 'city' => 'south florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '26.1333', 'lon' => '-80.1500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south jersey' => array( 'name' => 'South Jersey', 'city' => 'South Jersey', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.3773', 'lon' => '-74.4511', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south jersey', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast alaska' => array( 'name' => 'Southeast Alaska', 'city' => 'southeast alaska', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '58.3019', 'lon' => '134.4197', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast alaska', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast KS' => array( 'name' => 'Southeast KS', 'city' => 'southeast KS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.4109', 'lon' => '-94.7050', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast missouri' => array( 'name' => 'Southeast Missouri', 'city' => 'southeast missouri', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.3149', 'lon' => '-89.5280', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast missouri', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern illinois' => array( 'name' => 'Southern Illinois', 'city' => 'southern illinois', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.6557', 'lon' => '-88.9988', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern illinois', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern maryland' => array( 'name' => 'Southern Maryland', 'city' => 'southern maryland', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.4154', 'lon' => '-76.7041', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern maryland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern WV' => array( 'name' => 'Southern WV', 'city' => 'southern WV', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.6743', 'lon' => '-82.2774', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern WV', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest KS' => array( 'name' => 'Southwest KS', 'city' => 'southwest MS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0431', 'lon' => '-100.9210', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest michigan' => array( 'name' => 'Southwest Michigan', 'city' => 'southwest michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.1274', 'lon' => '-86.4257', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest MN' => array( 'name' => 'Southwest MN', 'city' => 'southwest MN', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.9242', 'lon' => '-93.3087', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest MN', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest TX' => array( 'name' => 'Southwest TX', 'city' => 'southwest TX', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.1275', 'lon' => '-103.2425', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest TX', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest VA' => array( 'name' => 'Southwest VA', 'city' => 'southwest VA', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.7098', 'lon' => '-81.9773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest VA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'space coast' => array( 'name' => 'Space Coast', 'city' => 'space coast', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '28.1167', 'lon' => '-80.6333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'space coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'spokane / coeur d'alene' => array( 'name' => 'Spokane / Coeur d'alene', 'city' => 'Spokane', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '47.6589', 'lon' => '-117.4250', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'spokane / coeur d'alene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'springfield' => array( 'name' => 'Springfield', 'city' => 'springfield', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.7817', 'lon' => '-89.6501', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'springfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st augustine' => array( 'name' => 'St Augustine', 'city' => 'st augustine', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '29.9012', 'lon' => '-81.3124', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st augustine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st cloud' => array( 'name' => 'St Cloud', 'city' => 'st cloud', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '45.5579', 'lon' => '-94.1632', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st cloud', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st george' => array( 'name' => 'St George', 'city' => 'st george', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0965', 'lon' => '-113.5684', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st george', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st joseph' => array( 'name' => 'St Joseph', 'city' => 'st joseph', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.7675', 'lon' => '-94.8467', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st joseph', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st louis' => array( 'name' => 'St. Louis', 'city' => 'st louis', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.6272', 'lon' => '-90.1978', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st louis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'state college' => array( 'name' => 'State College', 'city' => 'state college', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.7934', 'lon' => '-77.8600', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'state college', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'statesboro' => array( 'name' => 'Statesboro', 'city' => 'statesboro', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.4488', 'lon' => '-81.7832', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'statesboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'stillwater' => array( 'name' => 'Stillwater', 'city' => 'stillwater', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.1156', 'lon' => '-97.0584', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'stillwater', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'stockton' => array( 'name' => 'Stockton', 'city' => 'stockton', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.9756', 'lon' => '121.3008', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'stockton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'susanville' => array( 'name' => 'Susanville', 'city' => 'susanville', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4163', 'lon' => '-120.6530', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'susanville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'syracuse' => array( 'name' => 'Syracuse', 'city' => 'syracuse', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '43.0469', 'lon' => '-76.1444', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'syracuse', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tallahassee' => array( 'name' => 'Tallahassee', 'city' => 'Tallahassee', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.4550', 'lon' => '-84.2533', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tallahassee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tampa bay' => array( 'name' => 'Tampa Bay Area', 'city' => 'tampa bay', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '25.7891', 'lon' => '-80.2040', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tampa bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'terre haute' => array( 'name' => 'Terre Haute', 'city' => 'terre haute', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4667', 'lon' => '-87.4139', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'terre haute', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'texarkana' => array( 'name' => 'Texarkana', 'city' => 'texarkana', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.4251', 'lon' => '-94.0477', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'texarkana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'texoma' => array( 'name' => 'Texoma', 'city' => 'texoma', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.6357', 'lon' => '-96.6089', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'texoma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'the thumb' => array( 'name' => 'The Thumb', 'city' => 'the thumb', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.9709', 'lon' => '-82.4249', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'the thumb', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'toledo' => array( 'name' => 'Toledo', 'city' => 'toledo', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6656', 'lon' => '-83.5753', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'toledo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'topeka' => array( 'name' => 'Topeka', 'city' => 'topeka', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.0473', 'lon' => '-95.6752', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'topeka', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'treasure coast' => array( 'name' => 'Treasure Coast', 'city' => 'treasure coast', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '27.6500', 'lon' => '-80.3833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'treasure coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tri-cities' => array( 'name' => 'Tri-cities', 'city' => 'tri-cities', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '36.5484', 'lon' => '-82.5618', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tri-cities', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tucson' => array( 'name' => 'Tucson', 'city' => 'Tucson', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '32.2217', 'lon' => '-110.9264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tucson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tulsa' => array( 'name' => 'Tulsa', 'city' => 'Tulsa', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.1314', 'lon' => '95.9372', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tulsa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tuscaloosa' => array( 'name' => 'Tuscaloosa', 'city' => 'tuscaloosa', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.2098', 'lon' => '87.5692', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tuscaloosa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tuscarawas co' => array( 'name' => 'Tuscarawas Co', 'city' => 'tuscarawas co', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.3979', 'lon' => '-81.4279', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tuscarawas co', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'twin falls' => array( 'name' => 'Twin Falls', 'city' => 'twin falls', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.5558', 'lon' => '-114.4701', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'twin falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'twin tiers NY/PA' => array( 'name' => 'Twin Tiers NY/PA', 'city' => 'twin tiers NY/PA', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0898', 'lon' => '-76.8077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'twin tiers NY/PA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tyler / east TX' => array( 'name' => 'Tyler / East TX', 'city' => 'Tyler', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.3500', 'lon' => '95.3000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tyler / east TX', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'upper peninsula' => array( 'name' => 'Upper Peninsula', 'city' => 'upper peninsula', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.5375', 'lon' => '-87.3952', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'upper peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'utica-rome-oneida' => array( 'name' => 'Utica-Rome-Oneida', 'city' => 'utica-rome-oneida', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2372', 'lon' => '-75.4345', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'utica-rome-oneida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'valdosta' => array( 'name' => 'Valdosta', 'city' => 'valdosta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.8327', 'lon' => '-83.2785', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'valdosta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ventura county' => array( 'name' => 'Ventura County', 'city' => 'Ventura County', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '34.3600', 'lon' => '-119.1500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ventura county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'vermont' => array( 'name' => 'Vermont', 'city' => 'vermont', 'state' => 'VT', 'state_expanded' => 'Vermont', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.2035', 'lon' => '-72.5623', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'vermont', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'victoria' => array( 'name' => 'Victoria', 'city' => 'victoria', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.8053', 'lon' => '-97.0036', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'victoria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'visalia-tulare' => array( 'name' => 'Visalia-tulare', 'city' => 'visalia-tulare', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.3302', 'lon' => '-119.2921', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'visalia-tulare', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'waco' => array( 'name' => 'Waco', 'city' => 'waco', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '31.5514', 'lon' => '-97.1558', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'waco', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'washington' => array( 'name' => 'Washington', 'city' => 'Washington', 'state' => 'DC', 'state_expanded' => 'District of Columbia', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '38.9072', 'lon' => '-77.0369', 'background-class' => 'washingtondc-panel', 'background_class' => 'washingtondc-panel', 'key_value' => 'washington', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'waterloo / cedar falls' => array( 'name' => 'Waterloo / Cedar Falls', 'city' => 'waterloo / cedar falls', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.5349', 'lon' => '-92.4453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'waterloo / cedar falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'watertown' => array( 'name' => 'Watertown', 'city' => 'watertown', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.9748', 'lon' => '-75.9108', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'watertown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wausau' => array( 'name' => 'Wausau', 'city' => 'wausau', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.9591', 'lon' => '-89.6301', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wausau', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wenatchee' => array( 'name' => 'Wenatchee', 'city' => 'wenatchee', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4235', 'lon' => '-120.3103', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wenatchee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'west virginia (old)' => array( 'name' => 'West Virginia (old)', 'city' => 'west virginia (old)', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.3498', 'lon' => '-81.6326', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'west virginia (old)', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western IL' => array( 'name' => 'Western IL', 'city' => 'western IL', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4727', 'lon' => '-90.6854', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western IL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western KY' => array( 'name' => 'Western KY', 'city' => 'western KY', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0834', 'lon' => '-88.6000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western KY', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western maryland' => array( 'name' => 'Western Maryland', 'city' => 'western maryland', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.6255', 'lon' => '-78.6115', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western maryland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western massachusetts' => array( 'name' => 'Western Massachusetts', 'city' => 'Springfield', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.4617', 'lon' => '-72.8944', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western massachusetts', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western slope' => array( 'name' => 'Western Slope', 'city' => 'western slope', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.5754', 'lon' => '-107.7416', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western slope', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wichita' => array( 'name' => 'Wichita', 'city' => 'wichita', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.6889', 'lon' => '-97.3361', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wichita', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wichita falls' => array( 'name' => 'Wichita Falls', 'city' => 'wichita falls', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.9308', 'lon' => '-98.4849', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wichita falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'williamsport' => array( 'name' => 'Williamsport', 'city' => 'williamsport', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.2412', 'lon' => '-77.0011', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'williamsport', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wilmington' => array( 'name' => 'Wilmington', 'city' => 'wilmington', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.2233', 'lon' => '-77.9122', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wilmington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'winchester' => array( 'name' => 'Winchester', 'city' => 'winchester', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.1857', 'lon' => '78.1633', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'winchester', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'winston-salem' => array( 'name' => 'Winston-salem', 'city' => 'winston-salem', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0999', 'lon' => '-80.2442', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'winston-salem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'worcester / central MA' => array( 'name' => 'Worcester / Central MA', 'city' => 'Worcester', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.2667', 'lon' => '-71.8000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'worcester / central MA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wyoming' => array( 'name' => 'Wyoming', 'city' => 'wyoming', 'state' => 'WY', 'state_expanded' => 'Wyoming', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.0760', 'lon' => '-107.2903', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wyoming', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yakima' => array( 'name' => 'Yakima', 'city' => 'yakima', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.6021', 'lon' => '-120.5059', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yakima', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'york' => array( 'name' => 'York', 'city' => 'york', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.9669', 'lon' => '-76.7659', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'york', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'youngstown' => array( 'name' => 'Youngstown', 'city' => 'youngstown', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.0998', 'lon' => '-80.6495', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'youngstown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yuba-sutter' => array( 'name' => 'Yuba-sutter', 'city' => 'yuba-sutter', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.1404', 'lon' => '-121.6169', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yuba-sutter', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yuma' => array( 'name' => 'Yuma', 'city' => 'yuma', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.6927', 'lon' => '-114.6277', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yuma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'zanesville / cambridge' => array( 'name' => 'Zanesville / Cambridge', 'city' => 'zanesville / cambridge', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.0312', 'lon' => '-81.5885', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'zanesville / cambridge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ) ), 'metatag_description' => 'Jobs in Tulsa, Oklahoma.', 'title_for_layout' => 'Jobs in Tulsa, Oklahoma.', 'no_index' => true, 'isMobile' => false, 'isWorker' => false, 'isSales' => false, 'isEducator' => false, 'adminLoggedIn' => false, 'isEmployer' => false, 'loggedIn' => false, 'isFacebookAppUser' => false, 'campaign' => 'NONE', 'content_for_layout' => ' <div id="loadingScreen"></div> <script type="text/javascript"> var sortOrder = "relevance"; </script> <div id="proven-job-search"> <div class="container search voffset4"> <div class="row"> <div class="col-xs-12 col-md-9"> <div class="row search-row"> <div class="col-sm-5 col-xs-6 search-field"> <input type="text" name="data[Search][search_text]" value="" id="search_text" placeholder="Job Title, Keywords, or Company" /> </div> <div class="col-sm-5 col-xs-6 search-field"> <input type="text" value="tulsa" id="search-location" placeholder="City, State or Zip" /> </div> <div class="col-sm-2 col-xs-12 search-field" style="height:50px;"> <a href="#" id="search-btn" class="light-green-btn" role="button" style="width:100%;">SEARCH</a> </div> </div> </div> </div> </div> <div class="container voffset2"> <div class="row"> <div class="col-xs-12 col-sm-12 col-md-9"> <div class="row sort-items"> <div class="col-sm-6 col-xs-6" style="padding-left: 0px;"> <h1>Search Jobs in Northwest OK</h1> </div> <div class="col-sm-6 col-xs-6 text-right" style="padding-right: 0px;"> <a class="sort-link sort-order-link active" sort_order="relevance" href="#" title="Relevance">Relevance</a> | <a href="#" class="sort-link sort-order-link " sort_order="date" title="Date">Date</a> </div> </div> <div class="row container-border"> <div class="col-sm-12"> <script type="text/javascript"> $(document).ready(function() { $(".row.list-item").bind("mouseenter",function(){ $(this).css("cursor", "pointer"); }).bind("mouseleave",function(){ $(this).css("cursor", "default"); }).bind("click",function(e){ var target = $(e.target); if(!target.parent().hasClass("job-link")) { window.location.href = $(this).find(".job-link").attr("href"); } }); $(".j2-link").click(function(e) { e.preventDefault(); }); $(".sh-job").click(function(e) { e.preventDefault(); var query = $(this).html();//"company:(" + $(this).html() + ")"; $("#search_text").val(query); $("#search-btn").click(); }); }); </script> <div id="search-results"> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="label">FEATURED</div> <div class="cl"> </div> </div> <h2> <a onMouseDown="xml_sclk(this);" class="job-link blue-link" title="View Uber Driver Partner - Earn Extra Income" target="_blank" href="/jobs/viewJob/123"><strong>Uber Driver Partner - Earn Extra Income</strong></a> </h2> <p class="details"> Uber - Austin - 22 hours ago </p> <p class="description">$18.10 an hour - Part-time Drive with Uber and help your community get around town. Driving with Uber is a great way to earn extra money when you need it. It’s flexible and works with your schedule. And now, when you register for Instant Pay, you can get paid to your debit card up to 5x daily....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Uber Driver Partner - Earn Extra Income" target="_blank" href="/jobs/viewJob/123"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Sub Arc" href="https://www.jobs2careers.com/click.php?jid=6fe781b1478c73ec2a5117bb1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A1mLRBGZyR2ujpkP4%253Amom2HpTWl6lzmkJHLqTLoQ%253D%253D%253AQ5qV5jgTE9yewyF%252FjpbjpepZ57sVMWLpsq2ZNtfOxTB%252BeSgrFJEWPifw9DUpBRYa9AbQDizMeTYoNgYm%252Bb%252BqY3Dbwc6gAY30TCwc6dQYi5vhzRNb5oajwguGz7XbC5aJVEz4ws4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074101/" target="_blank"><strong>Sub Arc</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Weekend Sub Arc Welder Pay: $19+/hr. Hours: Friday-Sunday 5AM-5:30PM or 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Must be Able to position header at machine clamping using an overhead or jib crane; turn cranks or pushes buttons to...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Sub Arc" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1478c73ec2a5117bb1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A1mLRBGZyR2ujpkP4%253Amom2HpTWl6lzmkJHLqTLoQ%253D%253D%253AQ5qV5jgTE9yewyF%252FjpbjpepZ57sVMWLpsq2ZNtfOxTB%252BeSgrFJEWPifw9DUpBRYa9AbQDizMeTYoNgYm%252Bb%252BqY3Dbwc6gAY30TCwc6dQYi5vhzRNb5oajwguGz7XbC5aJVEz4ws4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074101/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Facilities Tech B" href="https://www.jobs2careers.com/click.php?jid=7162da8f173c73edc204a45e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A920t3wBzForp%252B7dM%253AO66Ih0yomSFKUJpTpCIEzw%253D%253D%253AG114Ux%252FYvpEhNgSaxbmAbtiZpmw%252FdSMvPVl4JLCtukcASS2Wq0yiC2b1FwFnPQ1QOHbBtYJB4y%252Fkdyyreb3iuzc4ND6i7DAK4Pm5VY1G0O4j%252FxWhhTAI2KWh7Y7htR7QcjTnku4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848402/" target="_blank"><strong>Facilities Tech B</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Facilities Tech B Pay: $18+/hr. Hours: Day Shift Job type: Temp (4-6 Months) Location: Catoosa, Oklahoma Job Description: This position involves comprehensive reporting and adept navigation of the maintenance CMMS system. Duties include conducting preventive maintenance and repairs on...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Facilities Tech B" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8f173c73edc204a45e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A920t3wBzForp%252B7dM%253AO66Ih0yomSFKUJpTpCIEzw%253D%253D%253AG114Ux%252FYvpEhNgSaxbmAbtiZpmw%252FdSMvPVl4JLCtukcASS2Wq0yiC2b1FwFnPQ1QOHbBtYJB4y%252Fkdyyreb3iuzc4ND6i7DAK4Pm5VY1G0O4j%252FxWhhTAI2KWh7Y7htR7QcjTnku4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848402/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Service Tech - $46 - 65" href="https://www.jobs2careers.com/click.php?jid=6ff6ecc1fa5c73ec2b47c0b01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ACOtYemEEBpoJj3sB%253Au7wj8XKzz%252BnDI%252BoVCReC2g%253D%253D%253AlryBxkLsxxdR5wIVkt87pgWkS5eQ%252BZVaA1vx5MngI1e%252BNPuHkyj8oOycKp5w2Tnzwmzrz%252FAaIvuUZg2JVepVx%252BbW0xCCg0nloZCMOOrhG03HCsrtkqsjR9YSGgAH4fF%252BOCYmM9o%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053241280/" target="_blank"><strong>Service Tech - $46 - 65</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Service Tech - $46 - 65" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ecc1fa5c73ec2b47c0b01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ACOtYemEEBpoJj3sB%253Au7wj8XKzz%252BnDI%252BoVCReC2g%253D%253D%253AlryBxkLsxxdR5wIVkt87pgWkS5eQ%252BZVaA1vx5MngI1e%252BNPuHkyj8oOycKp5w2Tnzwmzrz%252FAaIvuUZg2JVepVx%252BbW0xCCg0nloZCMOOrhG03HCsrtkqsjR9YSGgAH4fF%252BOCYmM9o%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053241280/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Repair Technician Lead" href="https://www.jobs2careers.com/click.php?jid=6fe781b3308c73ec2a51179c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AQ%252F1OJ2AEBCHyxAk0%253AxYSAQY2cTfF3Q%252BpxtJOWFA%253D%253D%253Ae6sQOraYSvQKqUPpzN3VsNJc2hT2aR1jUM6IgRCmAVbKPEmHbYSEQjoCq%252FCnaivZAHxVuvJHn4psd7bVI%252B0BhohtEVMREdlNb42RZHCZrZUjs2ncd9EM59nFTzFiAJPFFtUXA20TZE8frgbmP6Wi&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074132/" target="_blank"><strong>Repair Technician Lead</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Repair Technician Lead Pay: $25-28/hr. Hours: Monday- Friday, Possible Weekends Job Type: Temp to Hire Location: Tulsa, Oklahoma Benefits: 401(k) matching, employee assistance program, life insurance Job Description: Seeking a proactive Repair Technician Lead experienced in commercial roofing...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Repair Technician Lead" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b3308c73ec2a51179c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AQ%252F1OJ2AEBCHyxAk0%253AxYSAQY2cTfF3Q%252BpxtJOWFA%253D%253D%253Ae6sQOraYSvQKqUPpzN3VsNJc2hT2aR1jUM6IgRCmAVbKPEmHbYSEQjoCq%252FCnaivZAHxVuvJHn4psd7bVI%252B0BhohtEVMREdlNb42RZHCZrZUjs2ncd9EM59nFTzFiAJPFFtUXA20TZE8frgbmP6Wi&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074132/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Welder - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=6ffdce73167c73ec2bf5eb9e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AA7D8Cx4KNDSQ9xsx%253Ac%252F1530g9SRi61rGfYAvVZA%253D%253D%253A9oNoMUPj8jd6f95m1rwujltjSzUQvEgWnnTJErtiXQqHBOggz9J9l1V3r%252BFR5bsI20xJVSIMU4%252FVgBzjSuPLgphonl2EuQy%252FSUN78aF27XemPcDKl1dMI3adVDdav8CcnMpmeTZoMhK3ARSUj2A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30060457170/" target="_blank"><strong>Welder - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Welder - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ffdce73167c73ec2bf5eb9e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AA7D8Cx4KNDSQ9xsx%253Ac%252F1530g9SRi61rGfYAvVZA%253D%253D%253A9oNoMUPj8jd6f95m1rwujltjSzUQvEgWnnTJErtiXQqHBOggz9J9l1V3r%252BFR5bsI20xJVSIMU4%252FVgBzjSuPLgphonl2EuQy%252FSUN78aF27XemPcDKl1dMI3adVDdav8CcnMpmeTZoMhK3ARSUj2A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30060457170/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Service Tech" href="https://www.jobs2careers.com/click.php?jid=6fe781aefc8c73ec2a5116401&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AnoZ8MPScJivLhaSq%253AZko2V6ofKOHOHG77Og2BRg%253D%253D%253AQuzZxCftDpFJ7UAtN3sEQH%252FtYOvW7q5NxbWlHw37vW77A3xvM4u2Mwt6RDJo8Nv3nBTGZ1vGVN8iUGtcZG2Rpl2fz7O5Cp6%252FEmswr7KJwFXCUfYwGycyx2Rzas4ont0rZeSKG5M%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074064/" target="_blank"><strong>Service Tech</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Service Tech" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781aefc8c73ec2a5116401&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AnoZ8MPScJivLhaSq%253AZko2V6ofKOHOHG77Og2BRg%253D%253D%253AQuzZxCftDpFJ7UAtN3sEQH%252FtYOvW7q5NxbWlHw37vW77A3xvM4u2Mwt6RDJo8Nv3nBTGZ1vGVN8iUGtcZG2Rpl2fz7O5Cp6%252FEmswr7KJwFXCUfYwGycyx2Rzas4ont0rZeSKG5M%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074064/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb86272c73ec2b47b4cd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ABEorFyc0%252FBocuxT9%253A0auyhslrWVZ6MDikoO8OHg%253D%253D%253AhZETok%252BdrScztXTmE3Wd0lRn1UHjkMIQwX6uq8k6fPLF%252FbBs%252FaBvmY3IpQh1vIv1XJmnK%252FuLnb6cxEEvc%252BASU5x0w5WfGl3PP2rrZBpvtDGQOqlKa8YQ6vkZ5ZYPRxLUcFrTZifVdece2CoUyhE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236227/" target="_blank"><strong>Structural Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb86272c73ec2b47b4cd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ABEorFyc0%252FBocuxT9%253A0auyhslrWVZ6MDikoO8OHg%253D%253D%253AhZETok%252BdrScztXTmE3Wd0lRn1UHjkMIQwX6uq8k6fPLF%252FbBs%252FaBvmY3IpQh1vIv1XJmnK%252FuLnb6cxEEvc%252BASU5x0w5WfGl3PP2rrZBpvtDGQOqlKa8YQ6vkZ5ZYPRxLUcFrTZifVdece2CoUyhE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236227/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=7162da8e423c73edc204a44b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AfMlxJ9X34279DWZc%253Abo3giQ2w1jTIDbsuMsXOgg%253D%253D%253ASyY3RvhppgAT15Ys7swfpmf4JXiSuMVN4bo9w3AHBkuue27Mow91bzu%252F4gvwxiWE6Gf26FECzj2WyGnhd9%252F%252FILeyHv7HH6hC%252FcVfU6AG7vzwhTQy5Enzq1AxQF%252Br%252FLHbxX8INXieufk6Gadcy3I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848389/" target="_blank"><strong>Structural Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8e423c73edc204a44b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AfMlxJ9X34279DWZc%253Abo3giQ2w1jTIDbsuMsXOgg%253D%253D%253ASyY3RvhppgAT15Ys7swfpmf4JXiSuMVN4bo9w3AHBkuue27Mow91bzu%252F4gvwxiWE6Gf26FECzj2WyGnhd9%252F%252FILeyHv7HH6hC%252FcVfU6AG7vzwhTQy5Enzq1AxQF%252Br%252FLHbxX8INXieufk6Gadcy3I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848389/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Assembler" href="https://www.jobs2careers.com/click.php?jid=7037a4fe23dc73edd753434d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ARpsqUD39yA37TAwF%253A2qu%252FxqP%252BjPo8%252F3f%252B%252B8%252BY6w%253D%253D%253A6HPEIcKEM%252FQhy%252F2%252BUV1sboH0Nt6z8ZSUoCz7VVI273hqCl6o7thv9Uqw7aZR71CIasaPlBSJ6D4Fse9R4AjyUXXmkJebAWZdKSlSujLvgorhO2Z6XktZ4Y%252Bjsc%252B3daq%252Bgn5esg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30121104771/" target="_blank"><strong>Structural Assembler</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">This job was posted by : For more information, please see: Assembler {#aspanstylecolorblackstructuralassemblerspana}Pay: \$16-24hr. {#spanstylecolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylecolorblackd1624hrspan}Hours: Monday-Friday Day Shift {#spanstylecolorblackhoursspanspanstylecolorblackmondayfriday...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Assembler" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7037a4fe23dc73edd753434d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ARpsqUD39yA37TAwF%253A2qu%252FxqP%252BjPo8%252F3f%252B%252B8%252BY6w%253D%253D%253A6HPEIcKEM%252FQhy%252F2%252BUV1sboH0Nt6z8ZSUoCz7VVI273hqCl6o7thv9Uqw7aZR71CIasaPlBSJ6D4Fse9R4AjyUXXmkJebAWZdKSlSujLvgorhO2Z6XktZ4Y%252Bjsc%252B3daq%252Bgn5esg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30121104771/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View 6G Fitter Welder (Spools) - $27 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5ff25cc73edc0c5535d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AFtsFkP6vEfc1s3Vx%253AMzJxZaXlzbjCTBlYBi%252FGHw%253D%253D%253AXTW6Jv1EtbVUBbJ3QF%252F0DfGY9e%252FGDU3zsTbUHY8%252F2SuYzv4LRseCDMnMkK%252BqARiA0kQ%252Ft1G24sKSpnqiNBXn%252FwIHy%252FpegY%252FBq%252FC9y8UyKtUWxtkbaoq7IDZ19lrlyrb0HEmoaS57vHGxBtQbSP0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792659/" target="_blank"><strong>6G Fitter Welder (Spools) - $27 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">6G Fitter Welder (Spools) Pay: $27-28/hr. Hours: Monday-Friday 6AM-4:30PM (Saturday as needed) Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 6G Weld test Job Description: The role of the 6G Fitter Welder on Spools is pivotal in the fabrication and assembly of piping systems,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View 6G Fitter Welder (Spools) - $27 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5ff25cc73edc0c5535d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AFtsFkP6vEfc1s3Vx%253AMzJxZaXlzbjCTBlYBi%252FGHw%253D%253D%253AXTW6Jv1EtbVUBbJ3QF%252F0DfGY9e%252FGDU3zsTbUHY8%252F2SuYzv4LRseCDMnMkK%252BqARiA0kQ%252Ft1G24sKSpnqiNBXn%252FwIHy%252FpegY%252FBq%252FC9y8UyKtUWxtkbaoq7IDZ19lrlyrb0HEmoaS57vHGxBtQbSP0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792659/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $23 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5fd70cc73edc0c553781&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8lsRZESezHZ%252BC5E4%253AefIdO7i3tA5wSzhS%252B%252FLdZA%253D%253D%253AruICfiIE8h7N3bihsgyky4WbzTa3HJaQkhDDjxvFmMD%252FnGxPDGWSK7HGUVPVERXNKQAPWEoJdywy0m3iYAH85OYPmMlOU1AQO%252BpCKn5e8hbjeEKCOv5aKK2fDQFnmcobRUBY4uMSqFBWawpPRM8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792632/" target="_blank"><strong>Structural Welder - $23 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Welder Pay: $23-25/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join our team. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $23 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fd70cc73edc0c553781&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8lsRZESezHZ%252BC5E4%253AefIdO7i3tA5wSzhS%252B%252FLdZA%253D%253D%253AruICfiIE8h7N3bihsgyky4WbzTa3HJaQkhDDjxvFmMD%252FnGxPDGWSK7HGUVPVERXNKQAPWEoJdywy0m3iYAH85OYPmMlOU1AQO%252BpCKn5e8hbjeEKCOv5aKK2fDQFnmcobRUBY4uMSqFBWawpPRM8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792632/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder/Fitter - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=706ced2b364c73edd2e7de1c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ANrgG8upPeFcm%252BOyL%253AQrKYVqU3Zlw6rjW1c7VNUQ%253D%253D%253AH4IKR%252F7uHdvcFy5ga1BsnW4%252BgJjZ9nyzQ%252BloUcaXi65st2VBQDhsmgiCKxtm2QVz%252Bu6OB9GYpGt61CtML%252BtUhEbW9ruzXulXUcTPeBB%252F1XnAQLXv6dwtFnBMH6r%252BLGLf4ZyAWdeb2fmfqVrNTq8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974932/" target="_blank"><strong>Structural Welder/Fitter - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder/Fitter - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=706ced2b364c73edd2e7de1c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ANrgG8upPeFcm%252BOyL%253AQrKYVqU3Zlw6rjW1c7VNUQ%253D%253D%253AH4IKR%252F7uHdvcFy5ga1BsnW4%252BgJjZ9nyzQ%252BloUcaXi65st2VBQDhsmgiCKxtm2QVz%252Bu6OB9GYpGt61CtML%252BtUhEbW9ruzXulXUcTPeBB%252F1XnAQLXv6dwtFnBMH6r%252BLGLf4ZyAWdeb2fmfqVrNTq8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974932/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b0fc8c73ec2a5117a01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AUcFX9xfcwOklq%252FC0%253AxXZ%252B9NZVvduwpmBJ7E5ivQ%253D%253D%253AyMDnrRSIMTl8CHBG38%252F44cSqMkYwpM2bkk0EDT3Z6P7yYlJPcfuUd7BsDBHIEo0uRQCspw13dq8IumzXvJ%252FWAe6sfwVug2glOMONQvVtCjhILVME2cQc7SDpbRQl9zXxgvnP4AGD0waEKGTVC78%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074096/" target="_blank"><strong>Pipe Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b0fc8c73ec2a5117a01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AUcFX9xfcwOklq%252FC0%253AxXZ%252B9NZVvduwpmBJ7E5ivQ%253D%253D%253AyMDnrRSIMTl8CHBG38%252F44cSqMkYwpM2bkk0EDT3Z6P7yYlJPcfuUd7BsDBHIEo0uRQCspw13dq8IumzXvJ%252FWAe6sfwVug2glOMONQvVtCjhILVME2cQc7SDpbRQl9zXxgvnP4AGD0waEKGTVC78%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074096/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b2a98c73ec2a5117851&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AF1zl7xXPg3jfQ1a%252F%253AOlXJk4Sm8gAaKb4g%252FcCo6g%253D%253D%253AXBoyZUlvwOBgoLFlh9nbZBPUfQYcg6LPD%252FZYaV033ayvvoFCBp2JBgGx8DXFgCHpLgJuxYG62yaee09Nh4CXDE%252BD0%252Bbs0gZPWQ%252FKvNv6CVoZJw8ufSg4fy%252BiGp7dMLpu4nlwN7u24Ma%252BhGp3EKA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074123/" target="_blank"><strong>Pipe Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b2a98c73ec2a5117851&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AF1zl7xXPg3jfQ1a%252F%253AOlXJk4Sm8gAaKb4g%252FcCo6g%253D%253D%253AXBoyZUlvwOBgoLFlh9nbZBPUfQYcg6LPD%252FZYaV033ayvvoFCBp2JBgGx8DXFgCHpLgJuxYG62yaee09Nh4CXDE%252BD0%252Bbs0gZPWQ%252FKvNv6CVoZJw8ufSg4fy%252BiGp7dMLpu4nlwN7u24Ma%252BhGp3EKA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074123/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Fitter Welder - $27 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ea94d83c73ec2b47a5e21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Ad3yYxVKz8UNpMPc8%253AA3Sr5%252FPl%252BbE%252Fwzfc5F4m4Q%253D%253D%253A4zbSpckK%252BBMUJEj2WpdcL0JVjzmyvlCg5l0PA2%252FMgTOeyErcvKCy7D%252BzK2RRxnE8m9njgU7BBdNOK7UNdQU%252BHmkidAzA1HlJtljkAYPqRl1elYdX6qdmMfdA7mrPBPaHU5ztCxo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053232366/" target="_blank"><strong>Pipe Fitter Welder - $27 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Fitter Welder - $27 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ea94d83c73ec2b47a5e21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Ad3yYxVKz8UNpMPc8%253AA3Sr5%252FPl%252BbE%252Fwzfc5F4m4Q%253D%253D%253A4zbSpckK%252BBMUJEj2WpdcL0JVjzmyvlCg5l0PA2%252FMgTOeyErcvKCy7D%252BzK2RRxnE8m9njgU7BBdNOK7UNdQU%252BHmkidAzA1HlJtljkAYPqRl1elYdX6qdmMfdA7mrPBPaHU5ztCxo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053232366/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Fitter Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b09a8c73ec2a5117a61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AteqDrkD2NVS6ELJy%253AZjQP%252FHX%252FLHthg3ga2PCLqw%253D%253D%253A5jg2IelXAn3raHayqQ2AIfOo4NpRAaNpSQqJQ6zKBgCWg%252Fwd3ewss5khBXuzrQuPYjD8%252FJ%252F1dkqRyWN%252FBCkr9lSPbXQqpvAVSjsQs7OriS1I73Fj326vQuEWBNz8kfAK958QWXijeGGmfNuZau8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074090/" target="_blank"><strong>Pipe Fitter Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Fitter Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b09a8c73ec2a5117a61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AteqDrkD2NVS6ELJy%253AZjQP%252FHX%252FLHthg3ga2PCLqw%253D%253D%253A5jg2IelXAn3raHayqQ2AIfOo4NpRAaNpSQqJQ6zKBgCWg%252Fwd3ewss5khBXuzrQuPYjD8%252FJ%252F1dkqRyWN%252FBCkr9lSPbXQqpvAVSjsQs7OriS1I73Fj326vQuEWBNz8kfAK958QWXijeGGmfNuZau8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074090/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $25 - 29/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb90d82c73ec2b47b5a21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7PceJeG2fnk1xgEF%253AS3KNSosZj79DTjj3eweQUA%253D%253D%253AUMshNAfx5AAKypnAavaCb1cl%252FiJmJvGlZuio%252Bi9lXU9RmRDjizwKH0arYop83L8xFZ%252FScumIDzAk2wfcW1lHenoezicSxMCte31LJAzoiKNVK17DB%252F7JcJy%252FzdvjOqFpIx1MeqdmLSJng%252FiV5hk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236398/" target="_blank"><strong>Structural Welder - $25 - 29/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Class A or B Welders Pay: $25-29/hr. DOE Hours: Monday- Friday 5AM-3:30PM. Job Type: Temp-Hire Location: Catoosa, Oklahoma Test_:_ 2G and 3G GMAW, FCAW. 2\" 6G Super coupon GMAW, FCAW. 2\" 6G XX GTAW. Job Description: Responsible for performing welding functions per job specifications....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $25 - 29/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb90d82c73ec2b47b5a21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7PceJeG2fnk1xgEF%253AS3KNSosZj79DTjj3eweQUA%253D%253D%253AUMshNAfx5AAKypnAavaCb1cl%252FiJmJvGlZuio%252Bi9lXU9RmRDjizwKH0arYop83L8xFZ%252FScumIDzAk2wfcW1lHenoezicSxMCte31LJAzoiKNVK17DB%252F7JcJy%252FzdvjOqFpIx1MeqdmLSJng%252FiV5hk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236398/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ebe6362c73ec2b47b2cc1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AW6SmNrJhSOvdZQxq%253AIyqOqsyaB52f044kUMlDrg%253D%253D%253AsDKsq83HPNZc%252FbTsa9ziD4hpM2bquld5MNdWR2hPRWFFGXS3f0rcTYzHOnTaheLMNH0iptKfDcsok%252BQqL%252FEbN%252FMTzA61YdKEJhNHRp%252FNbquDjcYLFMKexM49ZePlONOTuhQZRdE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053237764/" target="_blank"><strong>Fitter Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Fitter Pay: $22/hr. Hours: Day Shift 6AM-4:30PM Job type: Temp to Hire Location: Sapulpa, Oklahoma Weld Test: Fitters Test Job Description: We're seeking a skilled Structural Fitter welder to ensure precise fabrication and adherence to quality and safety standards. Your responsibilities...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ebe6362c73ec2b47b2cc1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AW6SmNrJhSOvdZQxq%253AIyqOqsyaB52f044kUMlDrg%253D%253D%253AsDKsq83HPNZc%252FbTsa9ziD4hpM2bquld5MNdWR2hPRWFFGXS3f0rcTYzHOnTaheLMNH0iptKfDcsok%252BQqL%252FEbN%252FMTzA61YdKEJhNHRp%252FNbquDjcYLFMKexM49ZePlONOTuhQZRdE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053237764/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Field Service Technician Assistant - $15 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=70b73a23913c73eddf5aae961&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Azlul1lYBf82bzK5V%253Am9oM%252BBh%252B%252BsNeztyTpuxYuw%253D%253D%253AfKJKHUcpFiGBC5jPf43KfQjAyrAogNeF%252FK%252BfbF8Dh45G6ipb6O7gUSZiP09pO0MeYamSkx76FrU0%252FadKXV%252FJ5ZBmPskxIde%252BUUTolK4J0%252F8MKIA7MiHFQR%252BDjZIqy%252Batz3V%252BMdgLGI8BFhpOsGI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30254884826/" target="_blank"><strong>Overhead Crane Field Service Technician Assistant - $15 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Overhead Crane Field Service Technician Assistant Pay: $15-25/hr. Depending on experience Hours: 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: Join our team as an Overhead Crane Field Service Technician Assistant, where you'll play a crucial role in inspecting,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Field Service Technician Assistant - $15 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b73a23913c73eddf5aae961&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Azlul1lYBf82bzK5V%253Am9oM%252BBh%252B%252BsNeztyTpuxYuw%253D%253D%253AfKJKHUcpFiGBC5jPf43KfQjAyrAogNeF%252FK%252BfbF8Dh45G6ipb6O7gUSZiP09pO0MeYamSkx76FrU0%252FadKXV%252FJ5ZBmPskxIde%252BUUTolK4J0%252F8MKIA7MiHFQR%252BDjZIqy%252Batz3V%252BMdgLGI8BFhpOsGI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30254884826/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b59019fd9c73eddf700d301&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AY1uyHbI4a9z7PJj5%253A34hFyM%252BTwvbCt48FNYNjDQ%253D%253D%253AKrNA2JaWVZ6ioYX48vBXCFJhYoPBimGdBOTtj4zD5fgVoPr1XB7Tqb5hviyC132kyX3FNslsZPZ6owxDxJKSYgSWLyqr0ClAPQoY%252FLC4qGhAZWgSRyczJBCw2AnDgySLNIQ%252FL2I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139776/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b59019fd9c73eddf700d301&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AY1uyHbI4a9z7PJj5%253A34hFyM%252BTwvbCt48FNYNjDQ%253D%253D%253AKrNA2JaWVZ6ioYX48vBXCFJhYoPBimGdBOTtj4zD5fgVoPr1XB7Tqb5hviyC132kyX3FNslsZPZ6owxDxJKSYgSWLyqr0ClAPQoY%252FLC4qGhAZWgSRyczJBCw2AnDgySLNIQ%252FL2I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139776/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901e319c73eddf700d4c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5l2%252BTshAk6HOOpR5%253ARNjtJEEXwEO%252BeaIAdXOsrA%253D%253D%253Ah%252F3N1oIeBKm%252Bw4jmrr1WP4U9HipN%252FsN1VNX1398SewH9g9N%252BbIO4LVQ2U67aOYalEso09I%252FXR0vOFCdO2nrzgA%252Fc7OrABXFiMYxUr1kh1nsUN630lnJrG7bOmdRDeFlq4jeD%252B98%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139844/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27+/hr. Hours: Friday-Sunday 6AM-6PM (Work 36 Paid 40) Job type: Temp to Hire Location: Tulsa, Oklahoma Benefits: Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901e319c73eddf700d4c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5l2%252BTshAk6HOOpR5%253ARNjtJEEXwEO%252BeaIAdXOsrA%253D%253D%253Ah%252F3N1oIeBKm%252Bw4jmrr1WP4U9HipN%252FsN1VNX1398SewH9g9N%252BbIO4LVQ2U67aOYalEso09I%252FXR0vOFCdO2nrzgA%252Fc7OrABXFiMYxUr1kh1nsUN630lnJrG7bOmdRDeFlq4jeD%252B98%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139844/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901b759c73eddf700d181&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AREE%252BXK3qaUjEfyXD%253A8rC5P%252FtGYRK0yrYPmKwl9w%253D%253D%253AuTpaWgHNK1UNXRX1fwOPtlYltSJcVyD4aNxEUhf67YTwS6%252FVunqicmdM1WLSgBONRfS4VvmTk8qIa4kDfl0RN20pFG3RoQwb0ChO16mdOodSlCodVmQ1BBll%252BGEGhT2o1EeVp%252Fw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139800/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901b759c73eddf700d181&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AREE%252BXK3qaUjEfyXD%253A8rC5P%252FtGYRK0yrYPmKwl9w%253D%253D%253AuTpaWgHNK1UNXRX1fwOPtlYltSJcVyD4aNxEUhf67YTwS6%252FVunqicmdM1WLSgBONRfS4VvmTk8qIa4kDfl0RN20pFG3RoQwb0ChO16mdOodSlCodVmQ1BBll%252BGEGhT2o1EeVp%252Fw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139800/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter" href="https://www.jobs2careers.com/click.php?jid=701f8f0ecf6c73edd5d1fc431&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8msfo1JwwqRDnzoq%253Ahb1ftBYQHCG7XUQAGMkgOQ%253D%253D%253A65%252FnOGdUtrFcYkcP6KtUzF8IXyikgSonFcIFW7DsB94UviRN3B9XEOOVmw9ro9L8MYO3G276CzM6gPPm5O5NTb4zrY78K13sLJPy%252F8AJTnp1eiN%252FNkCqgTBGVG3VA%252BvQuPMuEs%252F%252FiF5Nhljd6rA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30095849101/" target="_blank"><strong>Structural Fitter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK </p> <p class="description">This job was posted by : For more information, please see: Fitter {#spanstylefontsize115ptcolorblackstructuralfitterspanspanstylefontsize115ptcolor666666span}Pay: \$22/hr. {#spanstylefontsize115ptcolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylefontsize115ptcolorblackd22hrspan}Hours:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=701f8f0ecf6c73edd5d1fc431&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8msfo1JwwqRDnzoq%253Ahb1ftBYQHCG7XUQAGMkgOQ%253D%253D%253A65%252FnOGdUtrFcYkcP6KtUzF8IXyikgSonFcIFW7DsB94UviRN3B9XEOOVmw9ro9L8MYO3G276CzM6gPPm5O5NTb4zrY78K13sLJPy%252F8AJTnp1eiN%252FNkCqgTBGVG3VA%252BvQuPMuEs%252F%252FiF5Nhljd6rA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30095849101/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Technician - $25 - 35/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eca4505c73ec2b47c6ea1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkGPdzAL4IQDI4HC5%253A6eGI61l%252FDrWK%252FkAG%252FfO3Qg%253D%253D%253Auik%252F2PKvp%252ByzzaUr605%252BM1Aqj7Mczj2JtlPl6jN7%252B2ztDZwyZIOzQ0j%252FT%252FAUQp2dPR5wLv7qIKcnWjcZejWWXW9BxhtqXgkykFFfOVOH2SYEpZNd00cd7h3Zg6HTw9qgrXsSzJyC3tR8bvRXRC2b&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053240806/" target="_blank"><strong>Overhead Crane Technician - $25 - 35/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Technician - $25 - 35/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eca4505c73ec2b47c6ea1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkGPdzAL4IQDI4HC5%253A6eGI61l%252FDrWK%252FkAG%252FfO3Qg%253D%253D%253Auik%252F2PKvp%252ByzzaUr605%252BM1Aqj7Mczj2JtlPl6jN7%252B2ztDZwyZIOzQ0j%252FT%252FAUQp2dPR5wLv7qIKcnWjcZejWWXW9BxhtqXgkykFFfOVOH2SYEpZNd00cd7h3Zg6HTw9qgrXsSzJyC3tR8bvRXRC2b&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053240806/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Louver Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901c9b9c73eddf700d661&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AVn1qjzSJYVlpqqe5%253AXtEzBRfpeveVxaCjrXQrRw%253D%253D%253AEsgKsWOWm1eWKrYrKKAjtG15Mv%252FFkemUBRfC37dj31AoOpMUlKmuJqpSZtOG8BiWtozZNl8qtw6NyyPbyujWORKOaOap1Bm0PUhoMTWfuD%252F1O6vld4mz4y%252B2FQPVtZvKud7tAxg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139818/" target="_blank"><strong>Structural Louver Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Louver Welder Pay: $22+/hr (Based on experience) Hours: Monday- Friday 5PM-5:30AM Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The Structural Louver welder must have proficiency in welding fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Louver Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901c9b9c73eddf700d661&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AVn1qjzSJYVlpqqe5%253AXtEzBRfpeveVxaCjrXQrRw%253D%253D%253AEsgKsWOWm1eWKrYrKKAjtG15Mv%252FFkemUBRfC37dj31AoOpMUlKmuJqpSZtOG8BiWtozZNl8qtw6NyyPbyujWORKOaOap1Bm0PUhoMTWfuD%252F1O6vld4mz4y%252B2FQPVtZvKud7tAxg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139818/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=7162da8ebd3c73edc204a4441&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A6HCD%252BY9c4kQf550F%253AbQTC65KyIRNwwT%252FV28G%252BVA%253D%253D%253A9OE1w%252FODHO446bQa6MgdlpshPlgT2uIf3nO4Aii5Gt7lSNND%252Bdc2nSZd%252BKUgXNWzOqYlqVm5iSpILNL2G%252BwPjJoxkvdA4F6H8D%252BkHB0f%252BV1s60vnSNLYCBsHj2cUkaBNGw%252FBxHo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848396/" target="_blank"><strong>Structural Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8ebd3c73edc204a4441&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A6HCD%252BY9c4kQf550F%253AbQTC65KyIRNwwT%252FV28G%252BVA%253D%253D%253A9OE1w%252FODHO446bQa6MgdlpshPlgT2uIf3nO4Aii5Gt7lSNND%252Bdc2nSZd%252BKUgXNWzOqYlqVm5iSpILNL2G%252BwPjJoxkvdA4F6H8D%252BkHB0f%252BV1s60vnSNLYCBsHj2cUkaBNGw%252FBxHo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848396/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder - $25 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eaf3413c73ec2b47a39b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASiwj7q2LbZOH72v4%253AgR6hyDSrfggPbEWZreZpbw%253D%253D%253AYlCV%252Bq3jFZT32IuXRKaWpOaWk%252BFNIRLcERKSR%252B09l2opZOhlwO3ImOZ2k3wvJoDj1vmQueO0ZbOAGlYjr17xQ2mrsLLuvwc3AUcNAkE5Gi8kCVkBd%252FcLtM%252B%252Bsj5zcn5p%252BP9sOPDg3QwYcxvWJ%252FA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053233877/" target="_blank"><strong>Fitter Welder - $25 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Fitter Welder Pay: $25-28+/hr. Hours: Monday-Saturday 6AM-4:30PM Job type: Temp to Hire Location: Broken Arrow, Oklahoma Weld Test: 6G Test Job Description: As a Fitter/Welder, you will play a crucial role in the production process. The ideal candidate will have a minimum of 2 years...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder - $25 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eaf3413c73ec2b47a39b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASiwj7q2LbZOH72v4%253AgR6hyDSrfggPbEWZreZpbw%253D%253D%253AYlCV%252Bq3jFZT32IuXRKaWpOaWk%252BFNIRLcERKSR%252B09l2opZOhlwO3ImOZ2k3wvJoDj1vmQueO0ZbOAGlYjr17xQ2mrsLLuvwc3AUcNAkE5Gi8kCVkBd%252FcLtM%252B%252Bsj5zcn5p%252BP9sOPDg3QwYcxvWJ%252FA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053233877/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Technician" href="https://www.jobs2careers.com/click.php?jid=6fe781aede8c73ec2a5116421&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AhJHGa%252FFL3JKZ%252FNi9%253A2kRR36b6iN3eR2aciqtBuQ%253D%253D%253AWDOTLTUDc9vPBahwJHkAJcZgtHME7o4Iv%252BmWBEfEUDStDDl%252Fz7ZznSLKKhTkPx5ehB7x%252B6L%252FVNXG2ngIIyJxt4afphbpw1vA0Py88kOR4CLj1A7A7G0J%252Fmp4BMfEiTOomO%252BWICHLajbW0FbWnHGq&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074062/" target="_blank"><strong>Overhead Crane Technician</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Technician" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781aede8c73ec2a5116421&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AhJHGa%252FFL3JKZ%252FNi9%253A2kRR36b6iN3eR2aciqtBuQ%253D%253D%253AWDOTLTUDc9vPBahwJHkAJcZgtHME7o4Iv%252BmWBEfEUDStDDl%252Fz7ZznSLKKhTkPx5ehB7x%252B6L%252FVNXG2ngIIyJxt4afphbpw1vA0Py88kOR4CLj1A7A7G0J%252Fmp4BMfEiTOomO%252BWICHLajbW0FbWnHGq&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074062/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Steel Fitters/Mig Flux Welder - $18/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5fc07cc73edc0c5536f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AroqtV6MxJdwZNgRi%253AoGCs8KoiZ449%252Fjp39rAfuw%253D%253D%253A14PkPXNLzDPJnj3HDmCkaMbwV%252Fsl%252FcKxqCPtVpeWVDeBGZiz4%252B2VvhXpdY1IjTAHxqvdTEss%252Bt%252BOLUrmDgBXzQd%252B%252FA%252B1YGNHsYR1lwEu6bnaqH11WxHwQ6dGju8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792609/" target="_blank"><strong>Structural Steel Fitters/Mig Flux Welder - $18/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Steel Fitters/Mig Flux Welder - $18/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fc07cc73edc0c5536f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AroqtV6MxJdwZNgRi%253AoGCs8KoiZ449%252Fjp39rAfuw%253D%253D%253A14PkPXNLzDPJnj3HDmCkaMbwV%252Fsl%252FcKxqCPtVpeWVDeBGZiz4%252B2VvhXpdY1IjTAHxqvdTEss%252Bt%252BOLUrmDgBXzQd%252B%252FA%252B1YGNHsYR1lwEu6bnaqH11WxHwQ6dGju8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792609/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder" href="https://www.jobs2careers.com/click.php?jid=702a0920290c73edd6899ead1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AiP4JVamI1bJn7t9G%253AsEeoaGmazCTEBqg1ArJugA%253D%253D%253AWf%252FG8GoOBLYlIyEz6UTy1riK7C794UigAYLvaXTGNonOCezyszG2kGj5witIn5CYcke7MPe5zF%252FnQJz3hilDYH0bx423tJXHaxTH2DBV6imrheR7j3CNzA0ki%252F5y6xuTTC82xkYuRT0WU5FXJUQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30106834851/" target="_blank"><strong>Fitter Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Fitter Welder Pay: $24-$32/hr. Multiple Shifts Available Location: Sand Springs, Oklahoma Must be able to pass drug test and background check. Shifts Available: Weekends: 6:00am-6:00pm OR 6:00pm-6:00am Friday-Sunday and some weekdays. Weekdays: 6:00am-6:00pm OR 6:00pm-6:00am 1 day off during...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=702a0920290c73edd6899ead1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AiP4JVamI1bJn7t9G%253AsEeoaGmazCTEBqg1ArJugA%253D%253D%253AWf%252FG8GoOBLYlIyEz6UTy1riK7C794UigAYLvaXTGNonOCezyszG2kGj5witIn5CYcke7MPe5zF%252FnQJz3hilDYH0bx423tJXHaxTH2DBV6imrheR7j3CNzA0ki%252F5y6xuTTC82xkYuRT0WU5FXJUQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30106834851/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View CNC Mill & Lathe Machinist" href="https://www.jobs2careers.com/click.php?jid=6fe781b0658c73ec2a5117a91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AEYboVl6FrqSzbtPr%253Ac2tdKnAy5LM8BXRwXAFR5g%253D%253D%253AFEnpZXw1uhNHa2QkEjCnpLYhabtU9jAUUp3Os6kTRp2RxbuSVzX4d5OPtiRbt%252Fl7r0kYuvQwCWHCZZnsGVwUuSm%252FSgBTNMMY%252FyLLReHi6N2Doozl4pxwHJOt6RqeCZNxeXGQmbE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074087/" target="_blank"><strong>CNC Mill & Lathe Machinist</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View CNC Mill & Lathe Machinist" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b0658c73ec2a5117a91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AEYboVl6FrqSzbtPr%253Ac2tdKnAy5LM8BXRwXAFR5g%253D%253D%253AFEnpZXw1uhNHa2QkEjCnpLYhabtU9jAUUp3Os6kTRp2RxbuSVzX4d5OPtiRbt%252Fl7r0kYuvQwCWHCZZnsGVwUuSm%252FSgBTNMMY%252FyLLReHi6N2Doozl4pxwHJOt6RqeCZNxeXGQmbE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074087/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901a649c73eddf700d091&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8s9itDjlP4LqslLH%253AMjUEqcCHK6hC%252BZgJIra%252Fsg%253D%253D%253AR8%252BM3V6rLmOZCIeh6fQVGLI57mkleaSTzE3piLdeJ4YeX8%252Fls4tuCFovK3a%252FFr5q3Mmrrs4ztPZrLRhay%252Fu1iXMdZGuc7K3aEeR0L11ztBXflyCW6jy%252FSdO%252FKn%252BdanBizVLs0Yw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139783/" target="_blank"><strong>Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901a649c73eddf700d091&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8s9itDjlP4LqslLH%253AMjUEqcCHK6hC%252BZgJIra%252Fsg%253D%253D%253AR8%252BM3V6rLmOZCIeh6fQVGLI57mkleaSTzE3piLdeJ4YeX8%252Fls4tuCFovK3a%252FFr5q3Mmrrs4ztPZrLRhay%252Fu1iXMdZGuc7K3aEeR0L11ztBXflyCW6jy%252FSdO%252FKn%252BdanBizVLs0Yw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139783/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder - $25/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb009c2c73ec2b47bca61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AypofVI%252FlG8rGCMlY%253Apkv1m3DJzJmyg4nEUJEbaA%253D%253D%253AIZtGv0qi9heznsszKV6AidmiPkI0StYr%252F4VND0BZs1yYyvXiesIIRu%252FPDSNLAGbYNKnpRV6QfOdSUxna%252FdUkQIRtSeQrnVR6kwkgVcE3Wr5eO3CvyGD6itTI6%252Bz1iDDOaW19qPg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053234090/" target="_blank"><strong>Structural Fitter / Welder - $25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder - $25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb009c2c73ec2b47bca61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AypofVI%252FlG8rGCMlY%253Apkv1m3DJzJmyg4nEUJEbaA%253D%253D%253AIZtGv0qi9heznsszKV6AidmiPkI0StYr%252F4VND0BZs1yYyvXiesIIRu%252FPDSNLAGbYNKnpRV6QfOdSUxna%252FdUkQIRtSeQrnVR6kwkgVcE3Wr5eO3CvyGD6itTI6%252Bz1iDDOaW19qPg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053234090/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View CNC Mill & Lathe Machinist - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ea70633c73ec2b47aba91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8EcB9ToIa%252BZcABDF%253AuZv%252FH6sQ4Hfdy8RjJOejqQ%253D%253D%253AoaKX5x4WuiFA2SlmH47rmgxMc7%252BCPnoplkocTIrfS0jmOSt0lCB6dPB262UTbsLk6j7geGkcpkDYm8IN1YRtBI8Pxxll3b3ej60yLuyPvmv5W8taS2hJfIhwTQA%252F9EpY9pfK1KMVJKelVQwZDg%252BD&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053231783/" target="_blank"><strong>CNC Mill & Lathe Machinist - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View CNC Mill & Lathe Machinist - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ea70633c73ec2b47aba91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8EcB9ToIa%252BZcABDF%253AuZv%252FH6sQ4Hfdy8RjJOejqQ%253D%253D%253AoaKX5x4WuiFA2SlmH47rmgxMc7%252BCPnoplkocTIrfS0jmOSt0lCB6dPB262UTbsLk6j7geGkcpkDYm8IN1YRtBI8Pxxll3b3ej60yLuyPvmv5W8taS2hJfIhwTQA%252F9EpY9pfK1KMVJKelVQwZDg%252BD&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053231783/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder/Fitter" href="https://www.jobs2careers.com/click.php?jid=706ced2a504c73edd2e7de0a1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ApNJumapE7wSRGwC8%253AFOkauSG0B%252FRtLxgH%252BqdOBg%253D%253D%253AoOjjcFIkjYJEv1Qbi%252Flp3QX9I6wkDIQhc1tZKdfVHW%252B0bjDX9xHH02PaZaAr3tCpm%252B4%252FDYNYEKd6GLtrlOezqOb0Dq%252BMiHrQm9KSt6KuoorQe4gRtme6eMe15XAr%252F%252FZZ6Id8Kj4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974918/" target="_blank"><strong>Structural Welder/Fitter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder/Fitter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=706ced2a504c73edd2e7de0a1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ApNJumapE7wSRGwC8%253AFOkauSG0B%252FRtLxgH%252BqdOBg%253D%253D%253AoOjjcFIkjYJEv1Qbi%252Flp3QX9I6wkDIQhc1tZKdfVHW%252B0bjDX9xHH02PaZaAr3tCpm%252B4%252FDYNYEKd6GLtrlOezqOb0Dq%252BMiHrQm9KSt6KuoorQe4gRtme6eMe15XAr%252F%252FZZ6Id8Kj4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974918/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Mill Machinist" href="https://www.jobs2careers.com/click.php?jid=711981a5218c73edc5b116fd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Aw9bR02i4qs%252BI05cV%253AvVbQ1fJBCscpzvkGP%252BucBw%253D%253D%253AAVLr3B8E37kd4AyTcU6Lu2gDd5roM%252FHz%252F2H8niE%252BEaDGxNGqTfdlopDTyoork7Yvh8jbhRKsh5ECErUfcohgWNH851iWwpx9EzpRuA3GnHmmUwXhCCcJxuLzlsxPLZ5tgZ2u6m0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30357938163/" target="_blank"><strong>Mill Machinist</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Claremore, OK </p> <p class="description">This job was posted by : For more information, please see: Machinist Pay: \$19/hr +. DOE Hours: Friday- Sunday 6AM-4PM OR 5PM- 3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Will set up and operate planner type milling machine that moves work piece back and forth against rigidly...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Mill Machinist" target="_blank" href="https://www.jobs2careers.com/click.php?jid=711981a5218c73edc5b116fd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Aw9bR02i4qs%252BI05cV%253AvVbQ1fJBCscpzvkGP%252BucBw%253D%253D%253AAVLr3B8E37kd4AyTcU6Lu2gDd5roM%252FHz%252F2H8niE%252BEaDGxNGqTfdlopDTyoork7Yvh8jbhRKsh5ECErUfcohgWNH851iWwpx9EzpRuA3GnHmmUwXhCCcJxuLzlsxPLZ5tgZ2u6m0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30357938163/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1ed8c73ec2a5117b11&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkIBNfVGSyi0PK93e%253AHF9G5NNfQ7MTl71W8%252BuFYw%253D%253D%253Ats3Wym383tMnA35y9WUonagdwsEUpT%252FL7a4zgThNgHl8eqrxuakAzHVYqfJUmY63eIp10oJBdj%252BMIEb%252FeqGA%252BOhlpPd%252BEa1cPm%252FtfOgyH%252BxPmH3xVjdv1jc5gpCW2%252BYY2zby6pHVzlLgyROgju0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074111/" target="_blank"><strong>Structural Fitter / Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Fitter / Welder Pay: $21-23/hr. Hours: Monday- Friday 6AM-4:30PM Job Type:Temp-Hire Location: Tulsa, Ok Benefits: 401k, 401k Matching, Dental insurance, Health insurance, Paid time off and Vision insurance. Job Description: Must pass an Mig and flux core 3G weld test on a...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1ed8c73ec2a5117b11&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkIBNfVGSyi0PK93e%253AHF9G5NNfQ7MTl71W8%252BuFYw%253D%253D%253Ats3Wym383tMnA35y9WUonagdwsEUpT%252FL7a4zgThNgHl8eqrxuakAzHVYqfJUmY63eIp10oJBdj%252BMIEb%252FeqGA%252BOhlpPd%252BEa1cPm%252FtfOgyH%252BxPmH3xVjdv1jc5gpCW2%252BYY2zby6pHVzlLgyROgju0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074111/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=716a7a270c3c73edc28eaedf1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AaPHDSfz98BsWOgym%253Alc8qUXizzfKBqxYfJhJzYg%253D%253D%253AwvujnOri15OW6Bdv%252FiMTkWglJo1i9%252FoubCufQIXkV%252B2BHFn1YFQMljYCu6QBY1IQ5O35GEPA8QWmCJCx9yVcbCb4snG9PVDaow%252FMHOWCYMNgUMRLn2wGxiqUzpamPUVjyz3UjyI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30442842129/" target="_blank"><strong>Structural Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 4 days ago </p> <p class="description">Structural Welder Pay: $26-27/hr. Hours: 5AM-4:30PM OR 5PM-4:30AM Job Type: Temp to Hire Location: North Owasso, Oklahoma Job Description: The Structural Welder performs welding tasks accurately and efficiently to meet project deadlines and quality expectations. Work autonomously with...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=716a7a270c3c73edc28eaedf1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AaPHDSfz98BsWOgym%253Alc8qUXizzfKBqxYfJhJzYg%253D%253D%253AwvujnOri15OW6Bdv%252FiMTkWglJo1i9%252FoubCufQIXkV%252B2BHFn1YFQMljYCu6QBY1IQ5O35GEPA8QWmCJCx9yVcbCb4snG9PVDaow%252FMHOWCYMNgUMRLn2wGxiqUzpamPUVjyz3UjyI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30442842129/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1cf8c73ec2a5117b31&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AH5foOXMA274ovXdr%253A1jQat9vy0nXapFnVgAKrNQ%253D%253D%253AoNhOgbXB9rZtJJuSruKD4X8lvy3Dw5sH%252BWqyYuox6INl%252BlI0t6SwLwkJbbuKop0YfQD6yRQjPAS66ufl78t7Iow1ktXU48y5FWQj7C0ZYAm4Fv1T7oZk0EV%252Br2WKxEJLZDqjiUCZfvxrDBmY%252FtI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074109/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1cf8c73ec2a5117b31&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AH5foOXMA274ovXdr%253A1jQat9vy0nXapFnVgAKrNQ%253D%253D%253AoNhOgbXB9rZtJJuSruKD4X8lvy3Dw5sH%252BWqyYuox6INl%252BlI0t6SwLwkJbbuKop0YfQD6yRQjPAS66ufl78t7Iow1ktXU48y5FWQj7C0ZYAm4Fv1T7oZk0EV%252Br2WKxEJLZDqjiUCZfvxrDBmY%252FtI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074109/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=7162da8dbd3c73edc204a4741&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASQ5%252FOayUGwJWXTWA%253AOsFMyA4hmoPoOd3QQ2tDcA%253D%253D%253AXEjaL2EPN%252FYYCSYWgaui3uiBt%252BFo0V0rdLqhwyBjcdFkBAVMD%252FXhs3CJYaLU%252B4hIAH0V0ZEwwJJolKW5RUSHSFrDi%252F%252BjLljmW4AlXIcl5B57GtDC6Q9a0KTOYoUZB78tkfKCjaoCwDTJiT%252FZbKQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848380/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8dbd3c73edc204a4741&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASQ5%252FOayUGwJWXTWA%253AOsFMyA4hmoPoOd3QQ2tDcA%253D%253D%253AXEjaL2EPN%252FYYCSYWgaui3uiBt%252BFo0V0rdLqhwyBjcdFkBAVMD%252FXhs3CJYaLU%252B4hIAH0V0ZEwwJJolKW5RUSHSFrDi%252F%252BjLljmW4AlXIcl5B57GtDC6Q9a0KTOYoUZB78tkfKCjaoCwDTJiT%252FZbKQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848380/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=703081ae038c73edd721164f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ADWA%252Bh4yQ%252BmIRx%252BVR%253A0Ibmg5FvRoCgTyC0Hg%252FDrw%253D%253D%253AmbP5aXQbJKIABIma4%252BYuu5JncUt1Yhfs63mlrWZi%252BbXUJ3JjwZrB0B45FeqvRxLnhtkKQVaWq4%252FzsfnA05yXLjXdwB8HfhKtlyc201DbjTWwlAihsxoRKik2zFA5me0ink%252B9Aw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30113620097/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - Yesterday </p> <p class="description">Structural Welder Pay: $18-22/hr. Hours: 6AM-4:30PM Job type: Temp to Hire Location: Owasso, Oklahoma Weld Test: 3G and 4G Mig Flux Core Job Description: As a Structural Welder with 3G and 4G, you will play a crucial role in the fabrication and assembly of various structural components....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=703081ae038c73edd721164f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ADWA%252Bh4yQ%252BmIRx%252BVR%253A0Ibmg5FvRoCgTyC0Hg%252FDrw%253D%253D%253AmbP5aXQbJKIABIma4%252BYuu5JncUt1Yhfs63mlrWZi%252BbXUJ3JjwZrB0B45FeqvRxLnhtkKQVaWq4%252FzsfnA05yXLjXdwB8HfhKtlyc201DbjTWwlAihsxoRKik2zFA5me0ink%252B9Aw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30113620097/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Steel Fitters/Mig Flux Welder" href="https://www.jobs2careers.com/click.php?jid=714ec5fb43cc73edc0c5531b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AeSaUPeke5UUA17s0%253ADIjsOaICftxfpUaB9iZYXg%253D%253D%253AmRzC8B5hSS2b4Rm62gxpBerlPlB0oKVYPRdt9E3DI91aKuWJJZGAYL630QAzWwuVzAOKv%252FxEljBJ%252FtbcWXVW%252BRiKUZM80d1suovtzqN%252B%252F4Y63BmKFoOUN2DCsHp%252FcXzQfMlbysGkHOc4dCEDqp0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792597/" target="_blank"><strong>Structural Steel Fitters/Mig Flux Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Steel Fitters/Mig Flux Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fb43cc73edc0c5531b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AeSaUPeke5UUA17s0%253ADIjsOaICftxfpUaB9iZYXg%253D%253D%253AmRzC8B5hSS2b4Rm62gxpBerlPlB0oKVYPRdt9E3DI91aKuWJJZGAYL630QAzWwuVzAOKv%252FxEljBJ%252FtbcWXVW%252BRiKUZM80d1suovtzqN%252B%252F4Y63BmKFoOUN2DCsHp%252FcXzQfMlbysGkHOc4dCEDqp0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792597/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder - $25 - 30/hr" href="https://www.jobs2careers.com/click.php?jid=717d83a3fcac73edc3f136901&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5KFz4bmsYr7PM%252FQh%253AYs9vX2wQqYXMW%252Bml2OqTrw%253D%253D%253AKL62fk%252Ft2AVigBcKVeBRPmQBqTTS%252F4dpzbOltxQSs%252B4hj4bCoro08huZBG5o1vWxVnsQE5gCT9I5NQjGC4sJT2wbvpgHPwc3xklquuk%252Bh4e4UZuIAGqNxlmtzBT5OSVsEuk0Pyk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803936/" target="_blank"><strong>Robotic Welder - $25 - 30/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder - $25 - 30/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a3fcac73edc3f136901&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5KFz4bmsYr7PM%252FQh%253AYs9vX2wQqYXMW%252Bml2OqTrw%253D%253D%253AKL62fk%252Ft2AVigBcKVeBRPmQBqTTS%252F4dpzbOltxQSs%252B4hj4bCoro08huZBG5o1vWxVnsQE5gCT9I5NQjGC4sJT2wbvpgHPwc3xklquuk%252Bh4e4UZuIAGqNxlmtzBT5OSVsEuk0Pyk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803936/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1128c73ec2a5117be1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AifDibtNGqltWkVK%252F%253AkvUWBtBvuRdFOPxl1oMYRQ%253D%253D%253AWSELE4uQbhVtdvteOOvY7FHnCty%252FHgR69ndr6vVPMoB8coSnnO6336PwS8xX8nlb11ove1dq%252BZLUyn99RQeJWMw4OQC7fuy9xQS6qHCWi%252FUtc4vHdq%252B8Ul1mJ0%252FHImiNRHs8oCM%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074098/" target="_blank"><strong>Structural Fitter / Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1128c73ec2a5117be1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AifDibtNGqltWkVK%252F%253AkvUWBtBvuRdFOPxl1oMYRQ%253D%253D%253AWSELE4uQbhVtdvteOOvY7FHnCty%252FHgR69ndr6vVPMoB8coSnnO6336PwS8xX8nlb11ove1dq%252BZLUyn99RQeJWMw4OQC7fuy9xQS6qHCWi%252FUtc4vHdq%252B8Ul1mJ0%252FHImiNRHs8oCM%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074098/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Traveling Field Service Fitter Welder - $28 - 30/hr" href="https://www.jobs2careers.com/click.php?jid=717d83a48bac73edc3f136e71&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AHHeQb4e1NYA5w0M5%253AHIz1sL7apzB1LWU4xhrd8g%253D%253D%253AX5FD99ly3Cz0lKc1sTtEN6KsvPTtss6zDXxyEzTxcFG9s8WW%252Bj8EKBKma2vwcvReGVHyp3FQlg7iecerB1tGlgTun%252FO%252B%252FD2WrhUQ%252FCVeOX58VHWEIuyup0LxoOXY9qGl1r7Zkv0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803945/" target="_blank"><strong>Traveling Field Service Fitter Welder - $28 - 30/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Traveling Field Service Fitter Welder - $28 - 30/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a48bac73edc3f136e71&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AHHeQb4e1NYA5w0M5%253AHIz1sL7apzB1LWU4xhrd8g%253D%253D%253AX5FD99ly3Cz0lKc1sTtEN6KsvPTtss6zDXxyEzTxcFG9s8WW%252Bj8EKBKma2vwcvReGVHyp3FQlg7iecerB1tGlgTun%252FO%252B%252FD2WrhUQ%252FCVeOX58VHWEIuyup0LxoOXY9qGl1r7Zkv0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803945/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Traveling Field Service Fitter Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=717d83a49aac73edc3f136e61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7sHzBVBSeVP7nTLL%253AnOE%252BSijuJf7tRMWb6%252FjeZg%253D%253D%253Am0HIinDyjJI2yv1krBAUjYG22ctIljvdOcxpN0Dab2F4Gm%252F6nptIeek7VnKrnNSBQSMy%252BVxQuIGu%252FGj60jrqmoJafint94vHNQCoo%252BI9ApuqBJ0tQfKG329blwzqOGvAjMYtq6A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803946/" target="_blank"><strong>Traveling Field Service Fitter Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Traveling Field Service Fitter Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a49aac73edc3f136e61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7sHzBVBSeVP7nTLL%253AnOE%252BSijuJf7tRMWb6%252FjeZg%253D%253D%253Am0HIinDyjJI2yv1krBAUjYG22ctIljvdOcxpN0Dab2F4Gm%252F6nptIeek7VnKrnNSBQSMy%252BVxQuIGu%252FGj60jrqmoJafint94vHNQCoo%252BI9ApuqBJ0tQfKG329blwzqOGvAjMYtq6A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803946/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=717d83a430ac73edc3f136ec1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AI4hYNPXrYO8Yx2Rz%253AcjyY9QBAjBKEdOZv0ycSZQ%253D%253D%253Au05shHupWvXq5vg%252BcsTX8yfNTKto%252BxfuPlBA70MUdXHnQcGBaxwsLVdM%252FQ5gN0iq%252BNPPgZxp5nfkEohNFYGf%252FoEBDCy84FlySWo3qj9WwCvoN9KVEjawnwn%252BkWLXHV5S6Le9Px4jiTGTr1r7Lvs%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803940/" target="_blank"><strong>Robotic Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a430ac73edc3f136ec1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AI4hYNPXrYO8Yx2Rz%253AcjyY9QBAjBKEdOZv0ycSZQ%253D%253D%253Au05shHupWvXq5vg%252BcsTX8yfNTKto%252BxfuPlBA70MUdXHnQcGBaxwsLVdM%252FQ5gN0iq%252BNPPgZxp5nfkEohNFYGf%252FoEBDCy84FlySWo3qj9WwCvoN9KVEjawnwn%252BkWLXHV5S6Le9Px4jiTGTr1r7Lvs%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803940/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Powder Coating Painter" href="https://www.jobs2careers.com/click.php?jid=716965f4a7cc73edc2bf53e51&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Ao31GVH5Y1fnzcsYf%253AWweuknErSVWaJeIeeWWedQ%253D%253D%253AB3D82UqOnqddkUOgFb3eOOW4XXtJleToleG1kGWFHqLe1gu2MjzqC%252BXvgB2AdQviI1YAWOjYIv1SlyV5GKYWPswqkXPWQOH3bE54NI%252BSAIuQ1O6u5pCiixXLJROfiddv9QecD9PekG6IkZuqMg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30441710827/" target="_blank"><strong>Powder Coating Painter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Claremore, OK </p> <p class="description">This job was posted by : For more information, please see: Coating Painter Pay: \$18-19/hr. Hours: Monday-Friday Day Shift Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Abrades surfaces of metal or hard composition objects to remove adhering scale, sand, paint, grease, tar, rust,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Powder Coating Painter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=716965f4a7cc73edc2bf53e51&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Ao31GVH5Y1fnzcsYf%253AWweuknErSVWaJeIeeWWedQ%253D%253D%253AB3D82UqOnqddkUOgFb3eOOW4XXtJleToleG1kGWFHqLe1gu2MjzqC%252BXvgB2AdQviI1YAWOjYIv1SlyV5GKYWPswqkXPWQOH3bE54NI%252BSAIuQ1O6u5pCiixXLJROfiddv9QecD9PekG6IkZuqMg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30441710827/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder" href="https://www.jobs2careers.com/click.php?jid=717d83a3deac73edc3f136921&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkW5UHUyHsc3ZavSI%253AOMGEzOeKhLqR7ALPqybvTg%253D%253D%253AJt%252B6Q5tp99C3Yd3t7x6DJ%252BmiTtERHMoNWV0SKq9u%252F292xEv0R6jxcAYbCd3l9yN1iRlpy1%252BWGEGxrIqYD4dAnYv6AY8yvdNUqYCtQr6DeU6vfdtyaSFtizEBHraF4dLIUUR0dw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803934/" target="_blank"><strong>Robotic Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a3deac73edc3f136921&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkW5UHUyHsc3ZavSI%253AOMGEzOeKhLqR7ALPqybvTg%253D%253D%253AJt%252B6Q5tp99C3Yd3t7x6DJ%252BmiTtERHMoNWV0SKq9u%252F292xEv0R6jxcAYbCd3l9yN1iRlpy1%252BWGEGxrIqYD4dAnYv6AY8yvdNUqYCtQr6DeU6vfdtyaSFtizEBHraF4dLIUUR0dw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803934/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Header Sub Arc/ Lance Operator" href="https://www.jobs2careers.com/click.php?jid=6fe781b2b88c73ec2a5117841&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ArAEKL5tsicrJ%252BUYn%253Ay6zCf%252FWjGVpPp8eoEuGCYA%253D%253D%253A7JXd%252BlrtAAU9OErOfOMLdBMy4a8ARroAEHPooAYKMjtSbA5MjVvMkdsxuBhpplPgEOiLdrAvtV6x9IR8LOY5LiqMXD8VUUk7V907566wGzBNFh9m4CpGEzaxePZP02Mlv5duAIQ1PaIYLYpAQrs4&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074124/" target="_blank"><strong>Header Sub Arc/ Lance Operator</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Header Sub Arc/ Lance Operator Pay: $19+/hr. (Depending on experience) Hours: 5PM-5:30AM Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: 1G Saw Plate Sub-Arc and 2G Plate Test (3years of experience required) Job Description: The ideal candidate will possess the ability...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Header Sub Arc/ Lance Operator" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b2b88c73ec2a5117841&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ArAEKL5tsicrJ%252BUYn%253Ay6zCf%252FWjGVpPp8eoEuGCYA%253D%253D%253A7JXd%252BlrtAAU9OErOfOMLdBMy4a8ARroAEHPooAYKMjtSbA5MjVvMkdsxuBhpplPgEOiLdrAvtV6x9IR8LOY5LiqMXD8VUUk7V907566wGzBNFh9m4CpGEzaxePZP02Mlv5duAIQ1PaIYLYpAQrs4&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074124/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row bottom-row"> <div class="col-xs-12 text-center"> <nav> <ul class="pagination"> <li class="prev"><a href="/jobs/search/tulsa?q=&page=13&sort=relevance" rel="prev">«</a></li><li><a href="/jobs/search/tulsa?q=&page=10&sort=relevance" currentLink="1">10</a></li><li><a href="/jobs/search/tulsa?q=&page=11&sort=relevance" currentLink="1">11</a></li><li><a href="/jobs/search/tulsa?q=&page=12&sort=relevance" currentLink="1">12</a></li><li><a href="/jobs/search/tulsa?q=&page=13&sort=relevance" currentLink="1">13</a></li><li class="active"><a>14</a></li><li><a href="/jobs/search/tulsa?q=&page=15&sort=relevance" currentLink="1">15</a></li><li><a href="/jobs/search/tulsa?q=&page=16&sort=relevance" currentLink="1">16</a></li><li><a href="/jobs/search/tulsa?q=&page=17&sort=relevance" currentLink="1">17</a></li><li class="next"><a href="/jobs/search/tulsa?q=&page=15&sort=relevance" rel="next">»</a></li> </ul> </nav> </div> </div> </div> </div> </div> </div> <div class="col-xs-12 col-md-3 hidden-sm voffset4"> <div class="iphone" style="border-bottom: 1px solid #231F20;"> <img src="/css/images/branding/worker_half_phone.png" class="center-block" /> </div> <p class="text-center"> Download our award winning mobile app and apply on the go. </p> <div class="row"> <div class="col-lg-6" style="margin-bottom:15px;"> <a href="/candidates/app" target="_blank" title="Download the iPhone App"> <img src="/css/images/App_Store_available.png" width="112" class="center-block" /> </a> </div> <div class="col-lg-6" style="margin-bottom:15px;"> <a href="/candidates/app/google" target="_blank" title="Download the Android App"> <img src="/css/images/google_play_badge.png" width="112" class="center-block" /> </a> </div> </div> <div class="panel panel-default voffset3"> <div class="panel-heading"> <strong>Jobs by City in Oklahoma</strong> </div> <div class="panel-body"> <ul class="list-unstyled"> <li><a href="/jobs/search/lawton" title="Jobs in Lawton">Lawton</a></li> <li><a href="/jobs/search/northwest-ok" title="Jobs in Northwest OK">Northwest OK</a></li> <li><a href="/jobs/search/oklahoma-city" title="Jobs in Oklahoma City">Oklahoma City</a></li> <li><a href="/jobs/search/stillwater" title="Jobs in Stillwater">Stillwater</a></li> <li><a href="/jobs/search/tulsa" title="Jobs in Tulsa">Tulsa</a></li> </ul> </div> </div> <div class="center-block voffset3"> <h4 class="text-center"><strong>Need to Hire?</strong></h4> <a onclick="javascript:showAcquiredModal()" title="Post a Job" class="red-btn request-demo">Get Started Now ⟶</a> <div class="clearfix"></div> </div> </div> </div> </div> </div> <div id="smb-landing-page"> <div class="light-gray-container bottom-menu"> <div class="container"> <div class="row voffset6 voffset6-bottom"> <div class="col-sm-3 col-sm-offset-0 col-xs-6"> <h4>Proven</h4> <ul class="list-unstyled voffset3"> <li><a href="/pages/ourStory" title="Our Story">Our Story</a></li> <li><a href="http://blog.proven.com" title="Blog">Blog</a></li> <li><a href="http://blog.proven.com/small-business-war-stories-podcast" title="Podcast">Podcast</a></li> <li><a href="/pages/press" title="Our Story">Press</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>For Job Seekers</h4> <ul class="list-unstyled voffset3"> <li><a href="/jobs" title="Search Jobs">Search Jobs</a></li> <li><a href="/candidates/app" title="Mobile App">Mobile App</a></li> <li><a href="/workers/join" title="Sign Up">Sign Up</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>For Employers</h4> <ul class="list-unstyled voffset3"> <li><a onclick="javascript:showAcquiredModal()" title="Post a Job for Free">Get Started</a></li> <li><a href="/pages/features" title="Features">Features</a></li> <li><a href="/pricing" title="Pricing">Pricing</a></li> <li><a href="/job-boards" title="Job Boards">Job Boards</a></li> <li><a href="https://blog.proven.com/proven-support">FAQ</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>Contact Us</h4> <ul class="list-unstyled voffset3"> <li><a href="/pages/contactUs" title="Email Us">Email Us</a></li> </ul> </div> </div> <div class="row"> <div class="col-sm-12 text-center"> <p><img src="/css/images/proven-logo.jpg" width="80" /></p> <p>We ♥ small businesses :-)</p> </div> <div class="col-sm-12 voffset4 bottom-panel text-center-xs"> <a href="http://www.facebook.com/pages/Provencom/352429835157" title="Facebook"><img src="/css/images/adcampaign/facebook.png" alt="Facebook" width="20" height="18" /></a> <a href="http://twitter.com/provenjobs" title="Twitter"><img src="/css/images/adcampaign/twitter.png" alt="Twitter" width="20" height="18" /></a> <ul class="list-inline list-unstyled voffset1"> <li>Copyright © 2024 Proven</li> <li>|</li> <li><a href="/pages/privacyPolicy" title="Privacy Policy">Privacy Policy</a></li> <li>|</li> <li><a href="/pages/termsCompanies" title="Terms of Service">Terms of Service</a></li> </ul> </div> </div> </div> </div> <!-- ACQUIRED MODAL START BELOW --> <link href="https://fonts.googleapis.com/css?family=Khula:300,400,600,700" rel="stylesheet"> <script type="text/javascript"> function showAcquiredModal() { $("#acquiredModal").modal("show"); } function hideAcquiredModal() { $("#acquiredModal").modal("hide"); } </script> <!-- ACQUIRED MODAL DIALOG --> <style> #acquiredModal { font-family: Khula,sans-serif; font-size:15px; line-height: 1.5; } #acquiredModal strong, #acquiredModal a, #acquiredModal p, #acquiredModal li { font-family: Khula,sans-serif; font-size:15px; } #acquiredModal a { color: #0076B8; } #acquiredModal li { text-align: justify; list-style-type: disc; margin-left:40px; } #acquiredModal a:visited { color: #3FB1E5; } #acquiredModal a:hover { color: #23315E; } #acquiredModal a:active { color: #0076B8; } #acquiredModal p { color: #666; font-weight: 400; width: 100%; margin: 0 0 1em; text-align: justify; } #acquiredModal .modal-footer { text-align: center; border-top: 0px solid #e5e5e5; } #acquiredModal .modal-header { border-bottom: 0px solid #e5e5e5; } @media only screen and (max-device-width: 640px){ #acquiredModal .modal-body { overflow-y: scroll; width: 100%; padding: 10px 20px !important; } } #acquiredModal .modal-content { -webkit-border-radius: 0px !important; -moz-border-radius: 0px !important; border-radius: 0px !important; } .fbimgbg { opacity: 0.5; filter: alpha(opacity=50); /* For IE8 and earlier */ } </style> <div id="acquiredModal" class="modal" tabindex="-1" role="dialog"> <div class="modal-dialog letter-width modal-lg" role="document"> <div class="modal-content"> <div class="modal-header" style="height:0"> <button type="button" class="close" data-dismiss="modal" aria-label="Close"> <span aria-hidden="true">×</span> </button> </div> <div class="modal-body" style="padding:30px 70px;"> <p style="font-size:21px;">Dear Proven Customer,</p> <p style="">Good news!</p> <p>Proven has been acquired and is joining forces with <a href="https://www.upward.net/employer/">Upward.net</a>.</p> <p>Over the past few months, the <a href="https://www.upward.net/employer/">Upward.net</a> technology team has been hard at work integrating some of the Proven features that you have grown accustomed to into the Proven platform.</p> <p>Our objective is to combine the Proven features with the <a href="https://www.upward.net/employer/">Upward.net</a> job distribution platform so that you can get even more candidates and have more flexibility than before.</p> <p>Here are a few things you should know.</p> <div><u>Logistical Details</u></div> <ul style="margin-bottom:1em"> <li>Your Proven account has been ported over to <a href="https://www.upward.net/employer/">Upward.net</a> (employer section)</li> <li>All of your historical information will be there</li> <li>Your username and credentials will remain the same, just log into <a href="https://www.upward.net/employer/">Upward.net</a> with your Proven username and password</li> <li>As of August 15th, you can post jobs on <a href="https://www.upward.net/employer/">Upward.net</a></li> <li>You will no longer be able to log into <a href="https://www.proven.com">Proven.com</a> directly</li> <li>If you have forgotten your Proven password, you can reset it by going <a href="https://www.upward.net/employer/">here</a> and following the 'forgot password' instructions and sign in</li> </ul> <p>If you have any questions about the transition, Upward.net's functionality or pricing, please contact us at <a href="mailto:support@upward.net">support@upward.net</a> or use the web chat functionality at <a href="https://www.upward.net/employer/">Upward.net</a>.</p> <p>We are tremendously grateful to the thousands of customers who have helped us succeed over the past decade. We could not have done this without you...Thank you!</p> <p></p> </div> <div class="modal-footer"> <div class="row"> <div class="col-sm-6 col-sm-offset-3"> <a href="https://www.upward.net/employer/" class="btn btn-warning btn-lg btn-block" style="color:#fff;padding-bottom:4px; margin-bottom:10px;">Login to Upward</a> </div> </div> </div> </div> </div> </div> </div>', 'scripts_for_layout' => '<link rel="stylesheet" type="text/css" href="/css/smoothness/jquery-ui-1.12.0.min.css?1619372464" /><script type="text/javascript" src="/js/jquery/jquery.ba-bbq-1.3.js?1619372466"></script><script type="text/javascript" src="/js/jquery/jquery.blockUI.2.66.js?1619372466"></script><script type="text/javascript" src="/js/jquery/jquery-ui-1.12.0.min.js?1619372465"></script><script type="text/javascript" src="/js/Views/Jobs/search_jobs.js?1619372465"></script>' ) $location_text = 'tulsa' $employers = array( (int) 0 => array( 'EmployersJob' => array( 'id' => (int) 123, 'anonymous_post' => (int) 0, 'description' => '<p>$18.10 an hour - Part-time</p> <p>Drive with Uber and help your community get around town. Driving with Uber is a great way to earn extra money when you need it. It’s flexible and works with your schedule. And now, when you register for Instant Pay, you can get paid to your debit card up to 5x daily.</p> <p>What you need to know:</p> <ul> <li>Earn extra money</li> <li>Make your own schedule as an independent contractor</li> <li>Cash out with Instant Pay</li> </ul> <p>Requirements:</p> <ul> <li>You're at least 21 years old</li> <li>You have an eligible 4-door vehicle</li> <li>You have a valid driver’s license</li> <li>You have at least one year of licensed experience in the U.S. (Three years if you are under 23 years old)</li> </ul>', 'title' => 'Uber Driver Partner - Earn Extra Income', 'post_date' => '2024-05-19', 'craigslist_city' => 'Austin', 'craigslist_state' => 'TX', 'featured' => (int) 1, 'ats_url' => 'https://www.proven.com/jobs/uber', 'company_name' => 'Uber', 'open' => (int) 1 ), 'Employer' => array( 'company_name' => 'Uber', 'company_logo' => '', 'id' => (int) 123, 'user_id' => (int) 0 ) ), (int) 1 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b1478c73ec2a5117bb1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A1mLRBGZyR2ujpkP4%253Amom2HpTWl6lzmkJHLqTLoQ%253D%253D%253AQ5qV5jgTE9yewyF%252FjpbjpepZ57sVMWLpsq2ZNtfOxTB%252BeSgrFJEWPifw9DUpBRYa9AbQDizMeTYoNgYm%252Bb%252BqY3Dbwc6gAY30TCwc6dQYi5vhzRNb5oajwguGz7XbC5aJVEz4ws4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074101/', 'title' => 'Sub Arc', 'description' => '<b>Weekend Sub Arc Welder</b><br><br> <b>Pay:</b> $19+/hr.<br><br> <b>Hours:</b> Friday-Sunday 5AM-5:30PM or 5:30PM-5AM (Work 36, paid 40)<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> Must be Able to position header at machine clamping using an overhead or jib crane; turn cranks or pushes buttons to align electrode on welding head over the welding joint. Ability to load reel of electrode wire onto machine and threads electrode wire from reel through feed rolls and welding head; turn welding head to set the specified angle of electrode. Fill hopper with specified flux and direct nozzle or gravity feed over weld line. Turn knobs to set current, voltage, and slope, and synchronize feed of wire and flux with speed of welding action. Ability to observe meters and gauges along with observing the weld action for compliance with procedures. Visually examine welds for adherence to specifications; grind welded surfaces as needed. Ability to operate pneumatic and electric grinders. Ability to use and utilize levels. Adjust machine setup to vary size, location, and penetration of bead, layout, fit, and tack work pieces together. Preheat work piece with hand torch or heating furnace; remove surplus slag, flux, and spatter. Ability to remove metal with carbon arc gouger to make repairs if necessary. Maintains production record of parts and jobs fabricated as required by the Department Manager. Regular attendance, ability to arrive at work punctually, ability to work on-site, ability to work overtime. Ability to work cooperatively with others, ability to deal respectfully with the public, customers, vendors, other employees, managers, and executive management. Ability to perform multiple tasks concurrently, ability to work in a fast-paced environment, ability to interchange with others in the department.<br><br> <b>Job Requirements:</b><br><br> High School Diploma or equivalent preferred. Must pass American Society of Mechanical Engineering 1g Saw Plate Test.<br><br> <b>Job Order #118016</b><br><br> <b>Stand-By Personnel Welding Division</b><br><br> We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br> Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br> Send your resume to ...@standbypersonnel.com<br><br> Follow us on Facebook [ <br><br> <b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br> Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:52Z' ) ), (int) 2 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=7162da8f173c73edc204a45e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A920t3wBzForp%252B7dM%253AO66Ih0yomSFKUJpTpCIEzw%253D%253D%253AG114Ux%252FYvpEhNgSaxbmAbtiZpmw%252FdSMvPVl4JLCtukcASS2Wq0yiC2b1FwFnPQ1QOHbBtYJB4y%252Fkdyyreb3iuzc4ND6i7DAK4Pm5VY1G0O4j%252FxWhhTAI2KWh7Y7htR7QcjTnku4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848402/', 'title' => 'Facilities Tech B', 'description' => '<b>Facilities Tech B</b><br><br> <b>Pay:</b> $18+/hr.<br><br> <b>Hours:</b> Day Shift<br><br> <b>Job type:</b> Temp (4-6 Months)<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> This position involves comprehensive reporting and adept navigation of the maintenance CMMS system. Duties include conducting preventive maintenance and repairs on HVAC systems, electrical systems, generators, and all facilities equipment. Compliance with LOTO procedures and adherence to Red Tag Permit Instructions from the insurance company are crucial aspects of the role. The facilities tech troubleshoots various building infrastructure systems and ensures that preventive measures meet safety standards. Monthly inspections on production equipment and replacement parts are conducted regularly. Collaboration with building management may be required for facility system renovations and improvements. Maintenance metrics may need to be reported to management, and coordination with department managers for monthly inspections is essential. A valid driver's license is necessary for driving to different locations within the Port. The ideal candidate demonstrates regular attendance, punctuality, and the ability to work on-site, and overtime as needed. Additionally, the ability to multitask in a fast-paced environment and collaborate effectively within the department is vital.<br><br> <b>Job Order 118558</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-14T00:22:06Z' ) ), (int) 3 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6ecc1fa5c73ec2b47c0b01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ACOtYemEEBpoJj3sB%253Au7wj8XKzz%252BnDI%252BoVCReC2g%253D%253D%253AlryBxkLsxxdR5wIVkt87pgWkS5eQ%252BZVaA1vx5MngI1e%252BNPuHkyj8oOycKp5w2Tnzwmzrz%252FAaIvuUZg2JVepVx%252BbW0xCCg0nloZCMOOrhG03HCsrtkqsjR9YSGgAH4fF%252BOCYmM9o%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053241280/', 'title' => 'Service Tech - $46 - 65', 'description' => '<b>Field Service Tech</b><br><br> <b>Pay:</b> $45-65k/ YR<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Pryor, Oklahoma<br><br> Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility.<br><br> <b>Job Description:</b><br><br> The Field Service Technician is responsible for the installation and operation upgrades, warranty, and general service calls. Services customers by providing on-site installation, preventive maintenance, equipment upgrades, warranty, and general service calls. Performs preventive and corrective maintenance routines on customer's equipment. Including disassembling, replacing, or repairing defective parts; rewiring or reassembling as required. Troubleshoots operational issues, adjusting, aligning, and calibrating to standards. Utilize schematics, diagrams, and technical manuals to restore operation. Provides quality installation of new bandsaws and train customers in their operations. Effectively communicates with sales, tech support, service manager and service coordinator. Develops relationships with customers by effectively communicating, scheduling calls, and exceeding their expectations Performs required administrative duties: maintain records, documentation and effectively plan work.<br><br> <b>Requirements:</b><br><br> Experience with material handling systems and/or overhead cranes. Experience in mechanical processes, hydraulics, and pneumatics with industrial machinery maintenance and repair. Confidential information with complete integrity. Mathematical skills. Must be computer literate. Must be able to lift up to 50 lbs.<br><br> <b>Job Order # 118208</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-12T00:25:11Z' ) ), (int) 4 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b3308c73ec2a51179c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AQ%252F1OJ2AEBCHyxAk0%253AxYSAQY2cTfF3Q%252BpxtJOWFA%253D%253D%253Ae6sQOraYSvQKqUPpzN3VsNJc2hT2aR1jUM6IgRCmAVbKPEmHbYSEQjoCq%252FCnaivZAHxVuvJHn4psd7bVI%252B0BhohtEVMREdlNb42RZHCZrZUjs2ncd9EM59nFTzFiAJPFFtUXA20TZE8frgbmP6Wi&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074132/', 'title' => 'Repair Technician Lead', 'description' => '<b>Repair Technician Lead</b><br><br><b>Pay:</b> $25-28/hr.<br><br><b>Hours:</b> Monday- Friday, Possible Weekends<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Tulsa, Oklahoma<br><br><b>Benefits:</b> 401(k) matching, employee assistance program, life insurance<br><br><b>Job Description:</b><br><br>Seeking a proactive Repair Technician Lead experienced in commercial roofing to oversee a two-person service crew. The ideal candidate should excel in problem-solving, have strong leadership skills, and understand commercial/industrial roof maintenance processes. Diagnose and solve water intrusion issues. Identify, document, and advise on necessary repairs/replacements. <br>Handle physical demands outlined in the Physical/Environmental Demands section. <br>Timely completion of paperwork and data input. Repair roofs, siding, windows, doors, and related constructions. <br>Ensure customer satisfaction through effective communication and service. <br>Address diverse project needs like storm, hail, water, fire, or insect damage. <br>Maintain a tidy work environment and assist the supervisor as needed.<br><br><b>Requirements:</b><br><br>Minimum 3 years' experience in commercial roofing. Valid driver's license. Strong leadership, organizational, and communication skills. Willingness to learn and follow company systems and procedures. Desire for continuous improvement through feedback. Comfortable working in a fast-paced, occasionally stressful environment. Some travel required. OSHA 10 Certification required; OSHA 30 Certification preferred. <br>Felon Friendly Job<br><br><b>Job Order #117792</b><br><br><b>Stand-By Personnel | Skilled Division</b><br><br><b>Application Time: 7:00 A.M. to 3:00P.M. Monday-Friday</b><br><br><b>Tulsa Office Locations:</b><br><br>4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br>1531 East 2nd Street Tulsa, Oklahoma 74120<br><br>14002 E 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br>6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br><b>Claremore Office Location:</b><br><br>507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br><b>Walk-ins always welcome!</b><br><br>$50 advance available after your first day of work<br><br>Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br><b>Referral Bonus: $125 for referring to a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b><br><br>"', 'post_date' => '2024-05-09T00:26:58Z' ) ), (int) 5 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ffdce73167c73ec2bf5eb9e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AA7D8Cx4KNDSQ9xsx%253Ac%252F1530g9SRi61rGfYAvVZA%253D%253D%253A9oNoMUPj8jd6f95m1rwujltjSzUQvEgWnnTJErtiXQqHBOggz9J9l1V3r%252BFR5bsI20xJVSIMU4%252FVgBzjSuPLgphonl2EuQy%252FSUN78aF27XemPcDKl1dMI3adVDdav8CcnMpmeTZoMhK3ARSUj2A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30060457170/', 'title' => 'Welder - $20 - 25/hr', 'description' => '<b>Mig & Fluxcore Welder</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> Monday-Friday 7AM-3:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Job Description:</b><br><br> As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision, attention to detail, and adherence to engineering specifications and safety standards are paramount in this role. You'll need expertise in flux-core and Mig welding on Carbon, as well as proficiency in TIG welding on Aluminum and Stainless steel.<br><br> <b>Job Order # 118419</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 6 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781aefc8c73ec2a5116401&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AnoZ8MPScJivLhaSq%253AZko2V6ofKOHOHG77Og2BRg%253D%253D%253AQuzZxCftDpFJ7UAtN3sEQH%252FtYOvW7q5NxbWlHw37vW77A3xvM4u2Mwt6RDJo8Nv3nBTGZ1vGVN8iUGtcZG2Rpl2fz7O5Cp6%252FEmswr7KJwFXCUfYwGycyx2Rzas4ont0rZeSKG5M%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074064/', 'title' => 'Service Tech', 'description' => '<b>Field Service Tech</b><br><br> <b>Pay:</b> $45-65k/ YR<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Pryor, Oklahoma<br><br> Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility.<br><br> <b>Job Description:</b><br><br> The Field Service Technician is responsible for the installation and operation upgrades, warranty, and general service calls. Services customers by providing on-site installation, preventive maintenance, equipment upgrades, warranty, and general service calls. Performs preventive and corrective maintenance routines on customer's equipment. Including disassembling, replacing, or repairing defective parts; rewiring or reassembling as required. Troubleshoots operational issues, adjusting, aligning, and calibrating to standards. Utilize schematics, diagrams, and technical manuals to restore operation. Provides quality installation of new bandsaws and train customers in their operations. Effectively communicates with sales, tech support, service manager and service coordinator. Develops relationships with customers by effectively communicating, scheduling calls, and exceeding their expectations Performs required administrative duties: maintain records, documentation and effectively plan work.<br><br> <b>Requirements:</b><br><br> Experience with material handling systems and/or overhead cranes. Experience in mechanical processes, hydraulics, and pneumatics with industrial machinery maintenance and repair. Confidential information with complete integrity. Mathematical skills. Must be computer literate. Must be able to lift up to 50 lbs.<br><br> <b>Job Order # 118208</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-09T00:26:50Z' ) ), (int) 7 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6eb86272c73ec2b47b4cd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ABEorFyc0%252FBocuxT9%253A0auyhslrWVZ6MDikoO8OHg%253D%253D%253AhZETok%252BdrScztXTmE3Wd0lRn1UHjkMIQwX6uq8k6fPLF%252FbBs%252FaBvmY3IpQh1vIv1XJmnK%252FuLnb6cxEEvc%252BASU5x0w5WfGl3PP2rrZBpvtDGQOqlKa8YQ6vkZ5ZYPRxLUcFrTZifVdece2CoUyhE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236227/', 'title' => 'Structural Welder - $22/hr', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $22+/hr.<br><br><b>Hours:</b> Monday- Friday 5:30PM-3AM<br><br><b>Job Type:</b> Temp-Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br> <b>Weld Test:</b> Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience)<br><br><b>Job Description:</b><br><br>Ability to weld fabricated parts of structural metal products in shop, plan sequence of operation and meet quality standards. Obtain specified electrode and inserts electrode into portable holder or threads consumable electrode wire through portable welding gun; connect cables from welding unit to obtain amperage, voltage, slope, and pulse, as specified by Welding Engineer or Welding Technician and be able to set welding machine wire feed and read blueprints. Must have 2 years Tig welding experience.<br><br><b>Job Order # 117365</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br><b>You can apply online at</b><br><br> [www.standbypersonnel.com](<br><br><b>Send your resume to</b> <br><br>...@standbypersonnel.com<br><br><b>Follow us on Facebook</b><br><br>[ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:11Z' ) ), (int) 8 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=7162da8e423c73edc204a44b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AfMlxJ9X34279DWZc%253Abo3giQ2w1jTIDbsuMsXOgg%253D%253D%253ASyY3RvhppgAT15Ys7swfpmf4JXiSuMVN4bo9w3AHBkuue27Mow91bzu%252F4gvwxiWE6Gf26FECzj2WyGnhd9%252F%252FILeyHv7HH6hC%252FcVfU6AG7vzwhTQy5Enzq1AxQF%252Br%252FLHbxX8INXieufk6Gadcy3I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848389/', 'title' => 'Structural Welder - $22/hr', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $22+/hr. (Based on experience)<br><br><b>Hours:</b> Monday- Friday Day and Night shift<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G and 3G Weld Test<br><br><b>Job Description:</b><br><br>The role requires proficiency in welding fabricated parts of structural metal products within a shop environment, ensuring adherence to quality standards. Candidates must be adept at planning the sequence of operations to meet project requirements. This entails obtaining specified electrodes and correctly inserting them into portable holders or threading consumable electrode wire through portable welding guns. Additionally, they must connect cables from welding units to obtain the specified amperage, voltage, slope, and pulse settings, as directed by the Welding Engineer or Welding Technician. The ability to set welding machine wire feed and interpret blueprints accurately is essential. <b>A minimum of 2 years of experience as a Fitter Welder is required for this position.</b><br><br><b>Job Order #118585</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-14T00:22:06Z' ) ), (int) 9 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=7037a4fe23dc73edd753434d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ARpsqUD39yA37TAwF%253A2qu%252FxqP%252BjPo8%252F3f%252B%252B8%252BY6w%253D%253D%253A6HPEIcKEM%252FQhy%252F2%252BUV1sboH0Nt6z8ZSUoCz7VVI273hqCl6o7thv9Uqw7aZR71CIasaPlBSJ6D4Fse9R4AjyUXXmkJebAWZdKSlSujLvgorhO2Z6XktZ4Y%252Bjsc%252B3daq%252Bgn5esg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30121104771/', 'title' => 'Structural Assembler', 'description' => '<p>This job was posted by : For more information, please see: Assembler {#aspanstylecolorblackstructuralassemblerspana}Pay: \$16-24hr. {#spanstylecolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylecolorblackd1624hrspan}Hours: Monday-Friday Day Shift {#spanstylecolorblackhoursspanspanstylecolorblackmondayfridaydayshiftspan}Job Type: Temp-Hire {#spanstylecolorblackjobtypespanspanstylecolorblacktemphirespan}Location: Tulsa,Oklahoma {#spanstylecolorblacklocationspanspanstylecolorblacktulsaspanspanstylecolorblackoklahomaspan}Job Description: {#spanstylecolorblackjobdescriptionspan}Minimum of two years experience with complex assemblies in the aerospace industry Military or aerospace industry experience with complex metallic or composite assemblies Airframe and power plant (A&P) license/certification, aircraft mechanic certifications, or like certifications extremely beneficial but not required. Must follow work instruction and be accountable for work performed. Good oral and written communication skills required. Must be able to read and interpret documents in English, Such as, operating and maintenance instructions, customer requirements, drawings and specifications to perform job functions. Able to fit check and assemble detail parts. Able to identify and properly install fasteners and sealants. Ability to work in a constant state of alertness and safe manner. {#spanstylecolorblackminimumoftwoyearsexperiencewithcomplexassembliesintheaerospaceindustrymilitaryoraerospaceindustryexperiencewithcomplexmetallicorcompositeassembliesairframeandpowerplantaplicensecertificationaircraftmechaniccertificationsorlikecertificationsextremelybeneficialbutnotrequiredmustfollowworkinstructionandbeaccountableforworkperformedgoodoralandwrittencommunicationskillsrequiredmustbeabletoreadandinterpretdocumentsinenglishsuchasoperatingandmaintenanceinstructionscustomerrequirementsdrawingsandspecificationstoperformjobfunctionsabletofitcheckandassembledetailpartsabletoidentifyandproperlyinstallfastenersandsealantsabilitytoworkinaconstantstateofalertnessandsafemannerspan}Position Qualifications: {#spanstylecolorblackpositionqualificationsspan}Accountability - Ability to accept responsibility and account for his/her actions. Detail Oriented - Ability to pay attention to the minute details of a project or task. Self-Motivated - Ability to be internally inspired to perform a task to the best of ones ability using his or her own drive or initiative. Team building - ability to convince a group of people to work toward a goal. Technical aptitude - ability to comprehend complex technical topics and specialized information. Ability to work in a constant state of alertness and safe manner. {#spanstylecolorblackaccountabilityabilitytoacceptresponsibilityandaccountforhisheractionsdetailorientedabilitytopayattentiontotheminutedetailsofaprojectortaskselfmotivatedabilitytobeinternallyinspiredtoperformatasktothebestofonesabilityusinghisorherowndriveorinitiativeteambuildingabilitytoconvinceagroupofpeopletoworktowardagoaltechnicalaptitudeabilitytocomprehendcomplextechnicaltopicsandspecializedinformationabilitytoworkinaconstantstateofalertnessandsafemannerspan}Physical Requirements: {#spanstylecolorblackphysicalrequirementsspan}May be required to push, pull, lift, and/or carry up to 50 pounds. Work involves extended periods of sitting and standing. Education/Experience: {#spanstylecolorblackmayberequiredtopushpullliftandorcarryupto50poundsworkinvolvesextendedperiodsofsittingandstandingeducationexperiencespan}Job Order #115880 {#spanstylecolorblackjoborder115880span}Stand-By Personnel \| Skilled Division {#spanstylefontsize120ptcolorblackstandbypersonnelskilleddivisionspanspanstylefontsize120ptspan}Application Time: 7:00 A.M. to 3:30 P.M. Monda -Friday {#spanstylefontsize120ptcolorblackapplicationtime700amto330pmmondayfridayspan}Tulsa Office Locations: {#uspanstylefontsize120ptcolorblacktulsaofficelocationsspanuuspanstylefontsize120ptcolorwindowtextspanu}4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146 {#spanstylefontsize120ptcolorblack4305smingoroadsuiteftulsaoklahoma74146spanspanstylefontsize120ptcolorwindowtextspan}1531 East 2nd Street Tulsa, Oklahoma 74120 {#spanstylecolorblack1531east2ndstreettulsaoklahoma74120span}14002 E 21^st^Street, Suite 38LL-1, Tulsa Oklahoma 74134 {#spanstylecolorblack14002e21supstsupstreetsuite38ll1tulsaoklahoma74134span}Tulsa Office Location: {#uspanstylecolorblacktulsaofficelocationspanuuspanstylecolorblackspanu}Application Times: 5am to 1pm, Monday-Friday {#spanstylecolorblackapplicationtimes5amto1pmmondayfridayspan}Skilled & Labor {#skilledlabor}6321 E. Admiral Place, Tulsa, Oklahoma 74115 {#6321eadmiralplacetulsaoklahoma74115}Claremore Office Location: {#uspanstylecolorblackclaremoreofficelocationspanu}</p>', 'post_date' => '2024-05-11T18:03:51Z' ) ), (int) 10 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=714ec5ff25cc73edc0c5535d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AFtsFkP6vEfc1s3Vx%253AMzJxZaXlzbjCTBlYBi%252FGHw%253D%253D%253AXTW6Jv1EtbVUBbJ3QF%252F0DfGY9e%252FGDU3zsTbUHY8%252F2SuYzv4LRseCDMnMkK%252BqARiA0kQ%252Ft1G24sKSpnqiNBXn%252FwIHy%252FpegY%252FBq%252FC9y8UyKtUWxtkbaoq7IDZ19lrlyrb0HEmoaS57vHGxBtQbSP0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792659/', 'title' => '6G Fitter Welder (Spools) - $27 - 28/hr', 'description' => '<b>6G Fitter Welder (Spools)</b><br><br><b>Pay:</b> $27-28/hr.<br><br><b>Hours:</b> Monday-Friday 6AM-4:30PM (Saturday as needed)<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Broken Arrow, Oklahoma<br><br><b>Test:</b> 6G Weld test<br><br><b>Job Description:</b><br><br>The role of the 6G Fitter Welder on Spools is pivotal in the fabrication and assembly of piping systems, fabrication, specializing in fitting and welding prefabricated pipe sections (spools). Responsibilities include interpreting blueprints, cutting, fitting, aligning pipe sections, and conducting welding operations using various techniques. Additionally, tasks involve pipefitting activities to ensure proper alignment and connection of spool sections, all while adhering to safety and industry standards.<br><br><b>Job Order #118543</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-11T00:12:44Z' ) ), (int) 11 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=714ec5fd70cc73edc0c553781&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8lsRZESezHZ%252BC5E4%253AefIdO7i3tA5wSzhS%252B%252FLdZA%253D%253D%253AruICfiIE8h7N3bihsgyky4WbzTa3HJaQkhDDjxvFmMD%252FnGxPDGWSK7HGUVPVERXNKQAPWEoJdywy0m3iYAH85OYPmMlOU1AQO%252BpCKn5e8hbjeEKCOv5aKK2fDQFnmcobRUBY4uMSqFBWawpPRM8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792632/', 'title' => 'Structural Welder - $23 - 25/hr', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $23-25/hr.<br><br><b>Hours:</b> Monday-Friday 5AM-3:30PM<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Broken Arrow, Oklahoma<br><br><b>Test:</b> 3G Weld test<br><br><b>Job Description:</b><br><br>We are seeking a skilled and experienced Structural Welder to join our team. The Structural Welder will be responsible for fabricating and assembling metal structures and components using various welding techniques. This role requires precision, attention to detail, and the ability to work with various materials in accordance with engineering specifications and safety standards.<br><br><b>Job Order #118559</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-11T00:12:43Z' ) ), (int) 12 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=706ced2b364c73edd2e7de1c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ANrgG8upPeFcm%252BOyL%253AQrKYVqU3Zlw6rjW1c7VNUQ%253D%253D%253AH4IKR%252F7uHdvcFy5ga1BsnW4%252BgJjZ9nyzQ%252BloUcaXi65st2VBQDhsmgiCKxtm2QVz%252Bu6OB9GYpGt61CtML%252BtUhEbW9ruzXulXUcTPeBB%252F1XnAQLXv6dwtFnBMH6r%252BLGLf4ZyAWdeb2fmfqVrNTq8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974932/', 'title' => 'Structural Welder/Fitter - $20 - 25/hr', 'description' => '<b>Structural Welder/Fitter</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Weld Tests:</b> Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted up - Test will be shot per code. Must carbon arc back then fill and cap with the same 3G Position.<br><br> <b>Benefits:</b> Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional development opportunities.<br><br> <b>Job Description:</b><br><br> Must have previous experience or ability to work with I-beam size ranges from 6 x 25 to 12 x 50\\. Finished units' range in envelope sizes from 8' x 20' to 16' x 50'. Must be able to read blueprints / drawings / general weld procedures. Structural Fitters take an open book written test. Overhead crane and forklift operations required. (AWS D1:1)<br><br> <b>Job Order # 114695</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br><b>Follow us on Facebook</b> [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 13 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b0fc8c73ec2a5117a01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AUcFX9xfcwOklq%252FC0%253AxXZ%252B9NZVvduwpmBJ7E5ivQ%253D%253D%253AyMDnrRSIMTl8CHBG38%252F44cSqMkYwpM2bkk0EDT3Z6P7yYlJPcfuUd7BsDBHIEo0uRQCspw13dq8IumzXvJ%252FWAe6sfwVug2glOMONQvVtCjhILVME2cQc7SDpbRQl9zXxgvnP4AGD0waEKGTVC78%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074096/', 'title' => 'Pipe Welder', 'description' => '<b>Pipe Welder</b><br><br> <b>Pay:</b> $25-28/hr. Depends on experience. Shift Differential.<br><br> <b>Hours:</b> Day and Night Shifts Available<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Weld Test:</b> Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160.<br><br> <b>Job Description:</b><br><br> <b>Must have at least 2 years of experience.</b><br><br> Responsible for set-up and operation of advanced welding equipment. This position uses expertise to solve problems and eliminate scrap, rework and downtime while effectively repairing defective products. The appearance of the repair work must be at an acceptable level and meet high quality standards. The Welder is also responsible for making sure all work is done to specification. A successful candidate is a self-motivated multi-tasker that utilizes a strong work ethic to ensure all quality levels are met.<br><br> <b>Job Order # 118097</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br><b>Follow us on Facebook</b> [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:50Z' ) ), (int) 14 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b2a98c73ec2a5117851&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AF1zl7xXPg3jfQ1a%252F%253AOlXJk4Sm8gAaKb4g%252FcCo6g%253D%253D%253AXBoyZUlvwOBgoLFlh9nbZBPUfQYcg6LPD%252FZYaV033ayvvoFCBp2JBgGx8DXFgCHpLgJuxYG62yaee09Nh4CXDE%252BD0%252Bbs0gZPWQ%252FKvNv6CVoZJw8ufSg4fy%252BiGp7dMLpu4nlwN7u24Ma%252BhGp3EKA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074123/', 'title' => 'Pipe Welder', 'description' => '<b>Pipe Welder</b><br><br> <b>Pay:</b> $27-28/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning, cutting, and aligning the metal pipes and components according to the blueprint specifications. Once prepared, pipe welders utilize various welding methods such as stick welding, TIG, and MIG to fuse the metal pipes together securely. Each technique may be chosen based on the type of metal, thickness, and other factors. Throughout the welding process, pipe welders ensure high standards of quality and precision to maintain safety and structural integrity. They also strictly adhere to safety protocols and procedures to prevent accidents and create a safe working environment for themselves and their colleagues. Overall, pipe welders play a crucial role in construction, manufacturing, and maintenance projects involving piping systems, contributing to the reliability and efficiency of various industrial processes.<br><br> <b>Requirements:</b><br><br>* 2+ Years of experience minimum required.<br><br> <b>Job Order # 113263</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:57Z' ) ), (int) 15 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6ea94d83c73ec2b47a5e21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Ad3yYxVKz8UNpMPc8%253AA3Sr5%252FPl%252BbE%252Fwzfc5F4m4Q%253D%253D%253A4zbSpckK%252BBMUJEj2WpdcL0JVjzmyvlCg5l0PA2%252FMgTOeyErcvKCy7D%252BzK2RRxnE8m9njgU7BBdNOK7UNdQU%252BHmkidAzA1HlJtljkAYPqRl1elYdX6qdmMfdA7mrPBPaHU5ztCxo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053232366/', 'title' => 'Pipe Fitter Welder - $27 - 28/hr', 'description' => '<b>Pipe Fitter Welder</b><br><br> <b>Pay:</b> $27-28/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination of the duties of a pipe fitter and a welder. Responsible for fitting and assembling piping systems according to the project specifications. This involves cutting, threading, bending, and aligning pipes to ensure they fit together properly. Quality Control: Pipe fitter welders inspect welded joints and pipe fittings to ensure they meet quality standards and specifications. They check for defects such as cracks, leaks, or irregularities and make any necessary repairs or adjustments.<br><br> <b>Job Order # 118274</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 16 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b09a8c73ec2a5117a61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AteqDrkD2NVS6ELJy%253AZjQP%252FHX%252FLHthg3ga2PCLqw%253D%253D%253A5jg2IelXAn3raHayqQ2AIfOo4NpRAaNpSQqJQ6zKBgCWg%252Fwd3ewss5khBXuzrQuPYjD8%252FJ%252F1dkqRyWN%252FBCkr9lSPbXQqpvAVSjsQs7OriS1I73Fj326vQuEWBNz8kfAK958QWXijeGGmfNuZau8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074090/', 'title' => 'Pipe Fitter Welder', 'description' => '<b>Pipe Fitter Welder</b><br><br> <b>Pay:</b> $27-28/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination of the duties of a pipe fitter and a welder. Responsible for fitting and assembling piping systems according to the project specifications. This involves cutting, threading, bending, and aligning pipes to ensure they fit together properly. Quality Control: Pipe fitter welders inspect welded joints and pipe fittings to ensure they meet quality standards and specifications. They check for defects such as cracks, leaks, or irregularities and make any necessary repairs or adjustments.<br><br> <b>Job Order # 118274</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:48Z' ) ), (int) 17 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6eb90d82c73ec2b47b5a21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7PceJeG2fnk1xgEF%253AS3KNSosZj79DTjj3eweQUA%253D%253D%253AUMshNAfx5AAKypnAavaCb1cl%252FiJmJvGlZuio%252Bi9lXU9RmRDjizwKH0arYop83L8xFZ%252FScumIDzAk2wfcW1lHenoezicSxMCte31LJAzoiKNVK17DB%252F7JcJy%252FzdvjOqFpIx1MeqdmLSJng%252FiV5hk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236398/', 'title' => 'Structural Welder - $25 - 29/hr', 'description' => '<b>Class A or B Welders</b><br><br> <b>Pay:</b> $25-29/hr. DOE<br><br> <b>Hours:</b> Monday- Friday 5AM-3:30PM.<br><br> <b>Job Type:</b> Temp-Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Test</b>_:_ 2G and 3G GMAW, FCAW. 2\" 6G Super coupon GMAW, FCAW. 2\" 6G XX GTAW.<br><br> <b>Job Description:</b><br><br> Responsible for performing welding functions per job specifications. Selects equipment and plans layout and assembly of welding. Works closely and interacts with supervision and QA/QC. Works with precise limits and standards of accuracy. Must be proficient at arc gouging. Capable of welding qualified processes without supervision. Must be knowledgeable in understanding and utilizing various blueprint drawings. Ability to utilize and interpret various measuring devices and weld symbols (Tape Measure, protractor, etc). Ability to read, analyze and interpret technical information, such as codes (ASME,API-650-620).<br><br> <b>Job Order # 116765</b><br><br> <b>Stand-By Personnel Welding Division</b><br><br> We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br> Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br> Send your resume to ...@standbypersonnel.com<br><br> Follow us on Facebook [<br><br> Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br> Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:11Z' ) ), (int) 18 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6ebe6362c73ec2b47b2cc1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AW6SmNrJhSOvdZQxq%253AIyqOqsyaB52f044kUMlDrg%253D%253D%253AsDKsq83HPNZc%252FbTsa9ziD4hpM2bquld5MNdWR2hPRWFFGXS3f0rcTYzHOnTaheLMNH0iptKfDcsok%252BQqL%252FEbN%252FMTzA61YdKEJhNHRp%252FNbquDjcYLFMKexM49ZePlONOTuhQZRdE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053237764/', 'title' => 'Fitter Welder - $22/hr', 'description' => '<b>Structural Fitter</b><br><br> <b>Pay:</b> $22/hr.<br><br> <b>Hours:</b> Day Shift 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Sapulpa, Oklahoma<br><br> <b>Weld Test:</b> Fitters Test<br><br> <b>Job Description:</b><br><br> We're seeking a skilled Structural Fitter welder to ensure precise fabrication and adherence to quality and safety standards. Your responsibilities will include interpreting drawings, operating cutting, and plasma torches, performing various welding processes, and maintaining equipment. You'll collaborate with the team to complete projects efficiently while upholding safety and quality standards.<br><br> <b>Key Responsibilities:</b><br><br> <b> </b>Interprets drawings for accurate fit-up and alignment.<br><br> Operate cutting and plasma torches proficiently.<br><br> Execute welding processes like GMAW and FCAW.<br><br> Safely maneuver equipment with cranes, jacks, and dollies.<br><br> Inspects work for defects and compliance with specifications.<br><br> Adhere to safety policies and quality procedures, and Report equipment or product defects promptly.<br><br> <b>Qualifications:</b><br><br> Experience in reading drawings and operating torches. Proficiency in GMAW and FCAW welding processes. Ability to operate cranes, jacks, and dollies safely. Attention to detail and commitment to quality. Strong communication and teamwork skills.<br><br> <b>Job Order # 113950</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:11Z' ) ), (int) 19 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b73a23913c73eddf5aae961&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Azlul1lYBf82bzK5V%253Am9oM%252BBh%252B%252BsNeztyTpuxYuw%253D%253D%253AfKJKHUcpFiGBC5jPf43KfQjAyrAogNeF%252FK%252BfbF8Dh45G6ipb6O7gUSZiP09pO0MeYamSkx76FrU0%252FadKXV%252FJ5ZBmPskxIde%252BUUTolK4J0%252F8MKIA7MiHFQR%252BDjZIqy%252Batz3V%252BMdgLGI8BFhpOsGI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30254884826/', 'title' => 'Overhead Crane Field Service Technician Assistant - $15 - 25/hr', 'description' => '<b>Overhead Crane Field Service Technician Assistant</b><br><br> <b>Pay:</b> $15-25/hr. Depending on experience<br><br> <b>Hours:</b> 8AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Claremore, Oklahoma<br><br> <b>Job Description:</b><br><br> Join our team as an Overhead Crane Field Service Technician Assistant, where you'll play a crucial role in inspecting, troubleshooting, and repairing the motors, drives, and electrical components of overhead crane and hoist systems. Your focus on exceeding customer expectations will drive your success in this role. Responsibilities include assisting the Overhead Crane Field Service Technician with troubleshooting, repairing, inspecting, and upgrading industrial hoists and cranes on-site at customer locations. Operating a company truck, you'll support service calls in the field and liaise with site maintenance and engineering personnel to assess equipment conditions. Effective communication with the office throughout the day ensures timely scheduling and completion of work. You'll also assist in conducting OSHA-required crane and hoist inspections, utilizing company-issued iPads to generate inspection reports. This role involves hands-on work in the inspection, repair, and load testing of various hoist styles. Additionally, participation in monthly safety meetings ensures a strong commitment to safety protocols. Additional duties may be assigned by supervisors or technicians, providing a diverse and engaging work environment.<br><br> <b>Requirements:</b><br><br> Experience with AC and DC electromechanical and solid-state motor control systems.<br><br> Knowledge of 3 phase power, control voltage, radio controls, and VFDs<br><br> Industrial electric motor and control experience is a plus.<br><br> Mechanical ability to work with gear reducers and drive systems is beneficial.<br><br> Strong communication skills for effective teamwork and independent work.<br><br> Basic computer skills to navigate web-based crane inspection programs.<br><br> Ability to troubleshoot problems and find solutions.<br><br> Must have a valid driver's license and acceptable driving record.<br><br> Demonstrated customer service skills.<br><br> Ability to pass a pre-employment drug test.<br><br> Commitment to always working and driving safely.<br><br> Flexibility for overtime, on-call shifts, occasional travel, and out-of-town work.<br><br> Ability to frequently lift up to 25 lbs and up to 50 lbs on a daily basis.<br><br><b>Job Order #118522</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-07T00:59:29Z' ) ), (int) 20 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b59019fd9c73eddf700d301&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AY1uyHbI4a9z7PJj5%253A34hFyM%252BTwvbCt48FNYNjDQ%253D%253D%253AKrNA2JaWVZ6ioYX48vBXCFJhYoPBimGdBOTtj4zD5fgVoPr1XB7Tqb5hviyC132kyX3FNslsZPZ6owxDxJKSYgSWLyqr0ClAPQoY%252FLC4qGhAZWgSRyczJBCw2AnDgySLNIQ%252FL2I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139776/', 'title' => 'Pipe Welder - Referral Bonus Available', 'description' => '<b>Pipe Welder</b><br><br> <b>Pay:</b> $27-28/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning, cutting, and aligning the metal pipes and components according to the blueprint specifications. Once prepared, pipe welders utilize various welding methods such as stick welding, TIG, and MIG to fuse the metal pipes together securely. Each technique may be chosen based on the type of metal, thickness, and other factors. Throughout the welding process, pipe welders ensure high standards of quality and precision to maintain safety and structural integrity. They also strictly adhere to safety protocols and procedures to prevent accidents and create a safe working environment for themselves and their colleagues. Overall, pipe welders play a crucial role in construction, manufacturing, and maintenance projects involving piping systems, contributing to the reliability and efficiency of various industrial processes.<br><br> <b>Requirements:</b><br><br>* 2+ Years of experience minimum required.<br><br> <b>Job Order # 113263</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-06T15:55:19Z' ) ), (int) 21 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b5901e319c73eddf700d4c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5l2%252BTshAk6HOOpR5%253ARNjtJEEXwEO%252BeaIAdXOsrA%253D%253D%253Ah%252F3N1oIeBKm%252Bw4jmrr1WP4U9HipN%252FsN1VNX1398SewH9g9N%252BbIO4LVQ2U67aOYalEso09I%252FXR0vOFCdO2nrzgA%252Fc7OrABXFiMYxUr1kh1nsUN630lnJrG7bOmdRDeFlq4jeD%252B98%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139844/', 'title' => 'Pipe Welder - Referral Bonus Available', 'description' => '<b>Pipe Welder</b><br><br> <b>Pay:</b> $27+/hr.<br><br> <b>Hours:</b> Friday-Sunday 6AM-6PM (Work 36 Paid 40)<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Benefits:</b> Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional development opportunities.<br><br> <b>Weld Test:</b> Stick Test- 12\" Pipe 6G down hill Mig 80D2 wire then 8018 stick uphill hot pass fill and cap xray 100% then send to lab for NDT. If Pass then take 12\" on 12\" branch test same stick procedure<br><br> <b>Job Description:</b><br><br> In this role, you will be responsible for the preparation, precise alignment, and secure assembly of components before welding. Using electric arc-welding equipment, you will weld together metal elements of various products, including piping systems, plates, pipes, and structural shapes. Your work will be guided by layouts, blueprints, diagrams, work orders, welding procedures, or verbal instructions. Additionally, you will plan installations and repairs to prevent obstructions and minimize disruption to other workers. Ensuring structural integrity, you will secure pipes to structures using brackets, clamps, and hangers, employing a combination of hand tools and power tools. Your welding expertise will be showcased in various directions, including flat, horizontal, vertical, and overhead positions. This role requires a keen eye for detail, proficiency in welding techniques, and the ability to work collaboratively while maintaining a commitment to safety and precision.<br><br> <b>Job Requirements:</b><br><br> Must be able to observe and recognize problems during the welding process and adjust the speed, voltage, amperage, or feed of the rod. Must be able to read and interpret prints and plans. Must be able to use tools properly. Must be able to weld carbon steel pipe. Must be able to do basic math. Must be able to make precise measurements. Use stick and Mig welding techniques to weld various components in varying positions.<br><br><b>Job Order # 115349</b><br><br><b>Stand-By Personnel Welding Division</b><br><br><b>Call or Text us at 918-###-####</b><br><br>We take walk-in applications from 7:00am to 3:30pm, Monday-Friday. <br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br><b>Follow us on Facebook</b> [ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-06T15:55:22Z' ) ), (int) 22 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b5901b759c73eddf700d181&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AREE%252BXK3qaUjEfyXD%253A8rC5P%252FtGYRK0yrYPmKwl9w%253D%253D%253AuTpaWgHNK1UNXRX1fwOPtlYltSJcVyD4aNxEUhf67YTwS6%252FVunqicmdM1WLSgBONRfS4VvmTk8qIa4kDfl0RN20pFG3RoQwb0ChO16mdOodSlCodVmQ1BBll%252BGEGhT2o1EeVp%252Fw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139800/', 'title' => 'Pipe Welder - Referral Bonus Available', 'description' => '<b>Pipe Welder</b><br><br> <b>Pay:</b> $25-28/hr. Depends on experience. Shift Differential.<br><br> <b>Hours:</b> Day and Night Shifts Available<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Weld Test:</b> Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160.<br><br> <b>Job Description:</b><br><br> <b>Must have at least 2 years of experience.</b><br><br> Responsible for set-up and operation of advanced welding equipment. This position uses expertise to solve problems and eliminate scrap, rework and downtime while effectively repairing defective products. The appearance of the repair work must be at an acceptable level and meet high quality standards. The Welder is also responsible for making sure all work is done to specification. A successful candidate is a self-motivated multi-tasker that utilizes a strong work ethic to ensure all quality levels are met.<br><br> <b>Job Order # 118097</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br><b>Follow us on Facebook</b> [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-06T15:55:20Z' ) ), (int) 23 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=701f8f0ecf6c73edd5d1fc431&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8msfo1JwwqRDnzoq%253Ahb1ftBYQHCG7XUQAGMkgOQ%253D%253D%253A65%252FnOGdUtrFcYkcP6KtUzF8IXyikgSonFcIFW7DsB94UviRN3B9XEOOVmw9ro9L8MYO3G276CzM6gPPm5O5NTb4zrY78K13sLJPy%252F8AJTnp1eiN%252FNkCqgTBGVG3VA%252BvQuPMuEs%252F%252FiF5Nhljd6rA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30095849101/', 'title' => 'Structural Fitter', 'description' => '<p>This job was posted by : For more information, please see: Fitter {#spanstylefontsize115ptcolorblackstructuralfitterspanspanstylefontsize115ptcolor666666span}Pay: \$22/hr. {#spanstylefontsize115ptcolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylefontsize115ptcolorblackd22hrspan}Hours: Day Shift 6AM-4:30PM {#spanstylefontsize115ptcolorblackhoursspanspanstylefontsize115ptcolor666666spanspanstylefontsize115ptcolorblackdayshift6am430pmspanspanstylefontsize115ptcolor666666span}Job type: Temp to Hire {#spanstylefontsize115ptcolorblackjobtypespanspanstylefontsize115ptcolorblacktemptohirespanspanstylefontsize115ptcolor666666span}Location: Sapulpa, Oklahoma {#spanstylefontsize115ptcolorblacklocationspanspanstylefontsize115ptcolorblacksapulpaoklahomaspan}Weld Test:Fitters Test {#spanstylefontsize115ptcolorblackweldtestspanspanstylefontsize115ptcolorblackfitterstestspan}Job Description: {#spanstylefontsize115ptcolorblackjobdescriptionspanspanstylecolorblackspan}We\'re seeking a skilled Structural Fitter welder to ensure precise fabrication and adherence to quality and safety standards. Your responsibilities will include interpreting drawings, operating cutting, and plasma torches, performing various welding processes, and maintaining equipment. You\'ll collaborate with the team to complete projects efficiently while upholding safety and quality standards. {#spanstylefontsize115ptcolorblackwereseekingaskilledstructuralfitterweldertoensureprecisefabricationandadherencetoqualityandsafetystandardsyourresponsibilitieswillincludeinterpretingdrawingsoperatingcuttingandplasmatorchesperformingvariousweldingprocessesandmaintainingequipmentyoullcollaboratewiththeteamtocompleteprojectsefficientlywhileupholdingsafetyandqualitystandardsspanspanstylefontsize115ptspan}Key Responsibilities: {#spanstylefontsize115ptcolorblackkeyresponsibilitiesspan}Interprets drawings for accurate fit-up and alignment. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblackinterpretsdrawingsforaccuratefitupandalignmentspan}Operate cutting and plasma torches proficiently. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblackoperatecuttingandplasmatorchesproficientlyspan}Execute welding processes like GMAW and FCAW. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblackexecuteweldingprocesseslikegmawandfcawspan}Safely maneuver equipment with cranes, jacks, and dollies. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblacksafelymaneuverequipmentwithcranesjacksanddolliesspan}Inspects work for defects and compliance with specifications. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblackinspectsworkfordefectsandcompliancewithspecificationsspan}Adhere to safety policies and quality procedures,andReport equipment or product defects promptly. {#spanstylefontsize115ptcolorblackspanspanstylefontsize115ptcolorblackadheretosafetypoliciesandqualityproceduresspanspanstylecolorblackandspanspanstylefontsize115ptcolorblackreportequipmentorproductdefectspromptlyspan}Qualifications: {#spanstylefontsize115ptcolorblackqualificationsspan}Experience in reading drawings and operating torches. Proficiency in GMAW and FCAW welding processes. Ability to operate cranes, jacks, and dollies safely. Attention to detail and commitment to quality. Strong communication and teamwork skills. {#spanstylefontsize115ptcolorblackexperienceinreadingdrawingsandoperatingtorchesproficiencyingmawandfcawweldingprocessesabilitytooperatecranesjacksanddolliessafelyattentiontodetailandcommitmenttoqualitystrongcommunicationandteamworkskillsspanspanstylefontsize115ptspan}Job Order # 113950 {#spanstylecolorblackjoborder113950spanspanstylefontsize115ptcolorblackspan}Stand-By Personnel Welding Division *We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.You can apply online at www.standbypersonnel.com {#youcanapplyonlineatspanstylefontsize120ptwwwstandbypersonnelcomspanhttpwwwstandbypersonnelcomspanstylefontsize120ptspan}Send your resume toFollow us on FacebookStand-By Personnel offers very competitive referral bonuses -- \$125 for a skilled worker, and \$200 for a welder. We also offer a \$50.00 advance after your first day of work.Stand-By Personnels Welding Division is a proven leader when it comes finding welders jobs. Stand-By staffs welders for many of the top companies in Oklahoma. Stand-By is the</p>', 'post_date' => '2024-05-19T18:20:32Z' ) ), (int) 24 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6eca4505c73ec2b47c6ea1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkGPdzAL4IQDI4HC5%253A6eGI61l%252FDrWK%252FkAG%252FfO3Qg%253D%253D%253Auik%252F2PKvp%252ByzzaUr605%252BM1Aqj7Mczj2JtlPl6jN7%252B2ztDZwyZIOzQ0j%252FT%252FAUQp2dPR5wLv7qIKcnWjcZejWWXW9BxhtqXgkykFFfOVOH2SYEpZNd00cd7h3Zg6HTw9qgrXsSzJyC3tR8bvRXRC2b&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053240806/', 'title' => 'Overhead Crane Technician - $25 - 35/hr', 'description' => '<b>Overhead Crane Field Service Technician</b><br><br> <b>Pay:</b> $25-35/hr.<br><br> <b>Hours:</b> Monday-Friday 8AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Claremore, Oklahoma<br><br> <b>Job Description:</b><br><br> The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the field at customer locations. Operates a company truck to make service calls in the field. Interface with site maintenance/engineering personnel regarding equipment condition. Communicates with the office frequently during the day so that work can be scheduled and completed on a timely basis. Performs OSHA required crane and hoist inspections and generate inspection reports via company-issued iPads. Participates in monthly safety meetings. Other duties assigned by supervisor.<br><br> <b>Qualifications:</b><br><br> A strong background in AC and DC electromechanical and solid-state motor control systems required. Experience in 3 phase power, control voltage, radio controls, and VFDs. 2 Years of prior industrial electric motor and control experience is required. Ability to read electrical schematics and wiring diagrams. (Able to troubleshoot without prints on occasion.) Some mechanical ability to work with gear reducers and drive systems. Basic computer skills to work with web-based crane inspection programs. Ability to troubleshoot problems and work toward a solution. OSHA Hoist and Crane inspection training. A valid driver's license and acceptable driving record. Ability to work overtime as required by customers, "on call" as part of our 24-hour customer service call program and able to travel and work out of town on occasion. Must be able to frequently lift up to 25 lbs. Must be able to lift up to 50 lbs. on a daily basis. Must be able to lift up to 75 lbs. although not on a daily basis. Must be able to lift 100 lbs. on a rare basis. This position requires frequent climbing, balancing, stooping/crouching, and overhead reaching. This position requires occasional pushing, pulling, kneeling, and crawling. This position will be inside approximately 90% of the time and outside approximately 10% of the time. This position will be frequently exposed to heat, cold, noise and heights.<br><br> <b>Job Order # 118232</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-12T00:25:11Z' ) ), (int) 25 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b5901c9b9c73eddf700d661&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AVn1qjzSJYVlpqqe5%253AXtEzBRfpeveVxaCjrXQrRw%253D%253D%253AEsgKsWOWm1eWKrYrKKAjtG15Mv%252FFkemUBRfC37dj31AoOpMUlKmuJqpSZtOG8BiWtozZNl8qtw6NyyPbyujWORKOaOap1Bm0PUhoMTWfuD%252F1O6vld4mz4y%252B2FQPVtZvKud7tAxg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139818/', 'title' => 'Structural Louver Welder - Referral Bonus Available', 'description' => '<b>Structural Louver Welder</b><br><br><b>Pay:</b> $22+/hr (Based on experience)<br><br><b>Hours:</b> Monday- Friday 5PM-5:30AM<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G and 3G Weld Test<br><br><b>Job Description:</b><br><br> The Structural Louver welder must have proficiency in welding fabricated parts of structural metal products within a workshop setting is essential. The ideal candidate will demonstrate the ability to meticulously plan the sequence of operations while consistently meeting stringent quality standards. This entails obtaining specified electrodes and adeptly inserting them into portable holders or threading consumable electrode wire through portable welding guns. Connecting cables from the welding unit to accurately achieve specified amperage, voltage, slope, and pulse settings, as dictated by Welding Engineers or Technicians, is crucial. Additionally, the candidate should be capable of configuring welding machine wire feed settings and interpreting blueprints with precision.<br><br><b>Job Order # 117643</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-06T15:55:20Z' ) ), (int) 26 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=7162da8ebd3c73edc204a4441&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A6HCD%252BY9c4kQf550F%253AbQTC65KyIRNwwT%252FV28G%252BVA%253D%253D%253A9OE1w%252FODHO446bQa6MgdlpshPlgT2uIf3nO4Aii5Gt7lSNND%252Bdc2nSZd%252BKUgXNWzOqYlqVm5iSpILNL2G%252BwPjJoxkvdA4F6H8D%252BkHB0f%252BV1s60vnSNLYCBsHj2cUkaBNGw%252FBxHo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848396/', 'title' => 'Structural Welder - Referral Bonus Available', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $22+/hr. (Based on experience)<br><br><b>Hours:</b> Monday- Friday Day and Night shift<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G and 3G Weld Test<br><br><b>Job Description:</b><br><br>The role requires proficiency in welding fabricated parts of structural metal products within a shop environment, ensuring adherence to quality standards. Candidates must be adept at planning the sequence of operations to meet project requirements. This entails obtaining specified electrodes and correctly inserting them into portable holders or threading consumable electrode wire through portable welding guns. Additionally, they must connect cables from welding units to obtain the specified amperage, voltage, slope, and pulse settings, as directed by the Welding Engineer or Welding Technician. The ability to set welding machine wire feed and interpret blueprints accurately is essential. <b>A minimum of 2 years of experience as a Fitter Welder is required for this position.</b><br><br><b>Job Order #118585</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-14T00:22:06Z' ) ), (int) 27 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6eaf3413c73ec2b47a39b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASiwj7q2LbZOH72v4%253AgR6hyDSrfggPbEWZreZpbw%253D%253D%253AYlCV%252Bq3jFZT32IuXRKaWpOaWk%252BFNIRLcERKSR%252B09l2opZOhlwO3ImOZ2k3wvJoDj1vmQueO0ZbOAGlYjr17xQ2mrsLLuvwc3AUcNAkE5Gi8kCVkBd%252FcLtM%252B%252Bsj5zcn5p%252BP9sOPDg3QwYcxvWJ%252FA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053233877/', 'title' => 'Fitter Welder - $25 - 28/hr', 'description' => '<b>Fitter Welder</b><br><br> <b>Pay:</b> $25-28+/hr.<br><br> <b>Hours:</b> Monday-Saturday 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Broken Arrow, Oklahoma<br><br> <b>Weld Test:</b> 6G Test<br><br> <b>Job Description:</b><br><br> As a Fitter/Welder, you will play a crucial role in the production process. The ideal candidate will have a minimum of 2 years of verifiable on-the-job pipe welding experience and be proficient in MIG, TIG, Flux Core, or Stick welding processes. our responsibilities will include: Welding using metal core MIG, TIG, Flux Core, or Stick processes (must pass two or more) Passing Mig & Flux core Pipe test and TIG all the way out - visual and x-ray Reading and understanding blueprints Operating basic cutting equipment and proficient in flame and plasma cutting torches Performing position welds on code materials Collaborating with the team to develop improved work processes Promoting and supporting safety, production, and a positive attitude<br><br> <b>Requirements:</b><br><br> Minimum of 2 years' verifiable on-the-job pipe welding and fitting experience Ability to pass applicable tests and non-destructive exams Experience with flame and plasma cutting torches. Proficiency in operating basic cutting equipment. Ability to read and understand blueprints. Excellent teamwork and communication skills. Strong commitment to safety and quality standards.<br><br> <b>Job Order # 118082</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 28 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781aede8c73ec2a5116421&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AhJHGa%252FFL3JKZ%252FNi9%253A2kRR36b6iN3eR2aciqtBuQ%253D%253D%253AWDOTLTUDc9vPBahwJHkAJcZgtHME7o4Iv%252BmWBEfEUDStDDl%252Fz7ZznSLKKhTkPx5ehB7x%252B6L%252FVNXG2ngIIyJxt4afphbpw1vA0Py88kOR4CLj1A7A7G0J%252Fmp4BMfEiTOomO%252BWICHLajbW0FbWnHGq&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074062/', 'title' => 'Overhead Crane Technician', 'description' => '<b>Overhead Crane Field Service Technician</b><br><br> <b>Pay:</b> $25-35/hr.<br><br> <b>Hours:</b> Monday-Friday 8AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Claremore, Oklahoma<br><br> <b>Job Description:</b><br><br> The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the field at customer locations. Operates a company truck to make service calls in the field. Interface with site maintenance/engineering personnel regarding equipment condition. Communicates with the office frequently during the day so that work can be scheduled and completed on a timely basis. Performs OSHA required crane and hoist inspections and generate inspection reports via company-issued iPads. Participates in monthly safety meetings. Other duties assigned by supervisor.<br><br> <b>Qualifications:</b><br><br> A strong background in AC and DC electromechanical and solid-state motor control systems required. Experience in 3 phase power, control voltage, radio controls, and VFDs. 2 Years of prior industrial electric motor and control experience is required. Ability to read electrical schematics and wiring diagrams. (Able to troubleshoot without prints on occasion.) Some mechanical ability to work with gear reducers and drive systems. Basic computer skills to work with web-based crane inspection programs. Ability to troubleshoot problems and work toward a solution. OSHA Hoist and Crane inspection training. A valid driver's license and acceptable driving record. Ability to work overtime as required by customers, "on call" as part of our 24-hour customer service call program and able to travel and work out of town on occasion. Must be able to frequently lift up to 25 lbs. Must be able to lift up to 50 lbs. on a daily basis. Must be able to lift up to 75 lbs. although not on a daily basis. Must be able to lift 100 lbs. on a rare basis. This position requires frequent climbing, balancing, stooping/crouching, and overhead reaching. This position requires occasional pushing, pulling, kneeling, and crawling. This position will be inside approximately 90% of the time and outside approximately 10% of the time. This position will be frequently exposed to heat, cold, noise and heights.<br><br> <b>Job Order # 118232</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 4305 South Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 14002 East 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> 6321 E Admiral Place, Tulsa, Oklahoma 74115<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-09T00:26:50Z' ) ), (int) 29 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=714ec5fc07cc73edc0c5536f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AroqtV6MxJdwZNgRi%253AoGCs8KoiZ449%252Fjp39rAfuw%253D%253D%253A14PkPXNLzDPJnj3HDmCkaMbwV%252Fsl%252FcKxqCPtVpeWVDeBGZiz4%252B2VvhXpdY1IjTAHxqvdTEss%252Bt%252BOLUrmDgBXzQd%252B%252FA%252B1YGNHsYR1lwEu6bnaqH11WxHwQ6dGju8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792609/', 'title' => 'Structural Steel Fitters/Mig Flux Welder - $18/hr', 'description' => '<b>Structural Steel Fitters/Mig Flux Welder</b><br><br><b>Pay:</b> $18+/hr.<br><br><b>Hours:</b> Monday-Friday 5AM-3:30PM<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Tulsa, Oklahoma<br><br><b>Test:</b> 3G Weld test<br><br><b>Job Description:</b><br><br>We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating and assembling metal structures and components using various welding techniques. This role requires precision, attention to detail, and the ability to work with various materials in accordance with engineering specifications and safety standards.<br><br>Candidate required to supply 12" adjustable wrench, 25' tape measure, and a ball peen or shop hammer not a nail driving claw type hammer. <br><br><b>Job Order #118568</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-11T00:12:43Z' ) ), (int) 30 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=702a0920290c73edd6899ead1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AiP4JVamI1bJn7t9G%253AsEeoaGmazCTEBqg1ArJugA%253D%253D%253AWf%252FG8GoOBLYlIyEz6UTy1riK7C794UigAYLvaXTGNonOCezyszG2kGj5witIn5CYcke7MPe5zF%252FnQJz3hilDYH0bx423tJXHaxTH2DBV6imrheR7j3CNzA0ki%252F5y6xuTTC82xkYuRT0WU5FXJUQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30106834851/', 'title' => 'Fitter Welder', 'description' => '<b>Fitter Welder</b><br><br><b>Pay:</b> $24-$32/hr.<br><br><b>Multiple Shifts Available</b><br><br><b>Location:</b> Sand Springs, Oklahoma<br><br>Must be able to pass drug test and background check.<br><br><b>Shifts Available:</b><br><br><b>Weekends:</b> 6:00am-6:00pm OR 6:00pm-6:00am Friday-Sunday and some weekdays. <br><b>Weekdays:</b> 6:00am-6:00pm OR 6:00pm-6:00am 1 day off during the week. <br><br><b>Job Description: </b><br><br> We're seeking experienced Class 1 Fitters who prioritize safety and excel in productivity, specializing in cutting, fitting, and tack welding diverse components for heat exchangers, vessels, and towers. The ideal candidate brings a minimum of 5 years' experience fitting pressure vessels or heat exchangers, coupled with at least 3 years' proficiency in Sub-Arc. Essential skills include fitting metal components to industry standards and codes for assembling and manufacturing pressure vessels and heat exchangers, along with extensive expertise in thermal cutting and welding. Candidates must accurately interpret AutoCAD prints, demonstrate proficiency in oxy/fuel cutting torches and Plas-Arc machines, and possess the ability to tack weld per code and within specified procedures.. A strong sense of pride in craftsmanship, punctuality, and reliability are integral qualities. Flexibility to work outside standard hours for project deadlines is expected, along with maintaining a fit-up rejection rate of under 5%. Additionally, physical requirements include exposure to welding fumes, gases, and grinder dust, with the mandatory use of PPE. The work environment lacks climate control, potentially exposing individuals to extreme heat or cold. Other physical requirements include safely lifting fifty pounds, working in varied weather conditions, productively navigating confined spaces within exchangers or vessels, and safely working from elevated heights atop exchangers or vessels, with the ability to tie off securely.<br><br>Job Order #113417<br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility.<br><br>"', 'post_date' => '2024-05-17T00:19:31Z' ) ), (int) 31 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b0658c73ec2a5117a91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AEYboVl6FrqSzbtPr%253Ac2tdKnAy5LM8BXRwXAFR5g%253D%253D%253AFEnpZXw1uhNHa2QkEjCnpLYhabtU9jAUUp3Os6kTRp2RxbuSVzX4d5OPtiRbt%252Fl7r0kYuvQwCWHCZZnsGVwUuSm%252FSgBTNMMY%252FyLLReHi6N2Doozl4pxwHJOt6RqeCZNxeXGQmbE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074087/', 'title' => 'CNC Mill & Lathe Machinist', 'description' => '<b>CNC Mill & Lathe Machinist</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> 1st shift , 2nd shift and weekend shift available!<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Job Requirements:</b><br><br> Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of the following machines: CNC Lathe, Vertical Mill, Manual Lathe.<br><br> <b>Job Description:</b><br><br> Climate-controlled Facility, for our Tulsa based client where fusion and fintube machines are produced. Machinists will place and secure parts, fixtures, and tools onto machines. Using the tools of the trade, machinists are expected to use micrometers, calipers and other tools and gauges to read, interpret and act on requirements and specifications on blueprints for a variety of parts. We need machinists with proven experience and success troubleshooting and resolving operation or programming problems.<br><br> <b>Job Order #116435</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 14002 E 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-09T00:26:56Z' ) ), (int) 32 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=70b5901a649c73eddf700d091&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8s9itDjlP4LqslLH%253AMjUEqcCHK6hC%252BZgJIra%252Fsg%253D%253D%253AR8%252BM3V6rLmOZCIeh6fQVGLI57mkleaSTzE3piLdeJ4YeX8%252Fls4tuCFovK3a%252FFr5q3Mmrrs4ztPZrLRhay%252Fu1iXMdZGuc7K3aEeR0L11ztBXflyCW6jy%252FSdO%252FKn%252BdanBizVLs0Yw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139783/', 'title' => 'Welder - Referral Bonus Available', 'description' => '<b>Mig & Fluxcore Welder</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> Monday-Friday 7AM-3:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Job Description:</b><br><br> As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision, attention to detail, and adherence to engineering specifications and safety standards are paramount in this role. You'll need expertise in flux-core and Mig welding on Carbon, as well as proficiency in TIG welding on Aluminum and Stainless steel.<br><br> <b>Job Order # 118419</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-06T15:55:19Z' ) ), (int) 33 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6eb009c2c73ec2b47bca61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AypofVI%252FlG8rGCMlY%253Apkv1m3DJzJmyg4nEUJEbaA%253D%253D%253AIZtGv0qi9heznsszKV6AidmiPkI0StYr%252F4VND0BZs1yYyvXiesIIRu%252FPDSNLAGbYNKnpRV6QfOdSUxna%252FdUkQIRtSeQrnVR6kwkgVcE3Wr5eO3CvyGD6itTI6%252Bz1iDDOaW19qPg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053234090/', 'title' => 'Structural Fitter / Welder - $25/hr', 'description' => '<b>Weekend Structural Fitter Welder</b><br><br> <b>Pay:</b> $25+/hr.<br><br> <b>Hours:</b> Friday-Sunday 5:30PM-5AM (Work 36, paid 40)<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms. Proficiency in blueprint reading for layout is required. Will be responsible for selecting equipment, planning layout, assembly, and welding. Tasks include positioning, aligning, and fitting components, as well as using tools like tape measure, square, combination square, level, and others for part fabrication according to blueprints. Simple mathematical calculations are needed to find part dimensions. The role involves performing 100% first article inspections, setting up welding machines, and operating cutting and plasma torches, as well as small saw and iron machines. Repairs involve dismantling, straightening, reshaping, and reassembling parts. Forklift operation is advantageous. The person should be able to identify and select different types of materials, operate various power tools, and load trucks manually. Other requirements include regular attendance, punctuality, ability to work cooperatively, and passing the American Welding Society 2g Plate Test/ Welding Bureau certification. One year of structural fitting experience is recommended.<br><br> <b>Job Order #118020</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 34 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6ff6ea70633c73ec2b47aba91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8EcB9ToIa%252BZcABDF%253AuZv%252FH6sQ4Hfdy8RjJOejqQ%253D%253D%253AoaKX5x4WuiFA2SlmH47rmgxMc7%252BCPnoplkocTIrfS0jmOSt0lCB6dPB262UTbsLk6j7geGkcpkDYm8IN1YRtBI8Pxxll3b3ej60yLuyPvmv5W8taS2hJfIhwTQA%252F9EpY9pfK1KMVJKelVQwZDg%252BD&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053231783/', 'title' => 'CNC Mill & Lathe Machinist - $20 - 25/hr', 'description' => '<b>CNC Mill & Lathe Machinist</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> 1st shift , 2nd shift and weekend shift available!<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Job Requirements:</b><br><br> Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of the following machines: CNC Lathe, Vertical Mill, Manual Lathe.<br><br> <b>Job Description:</b><br><br> Climate-controlled Facility, for our Tulsa based client where fusion and fintube machines are produced. Machinists will place and secure parts, fixtures, and tools onto machines. Using the tools of the trade, machinists are expected to use micrometers, calipers and other tools and gauges to read, interpret and act on requirements and specifications on blueprints for a variety of parts. We need machinists with proven experience and success troubleshooting and resolving operation or programming problems.<br><br> <b>Job Order #116435</b><br><br> <b>Stand-By Personnel | Skilled Division</b><br><br> <b>Application Time: 7:00 A.M. to 3:00 P.M. Monday-Friday</b><br><br> <b>Tulsa Office Locations:</b><br><br> 4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146<br><br> 1531 East 2nd Street Tulsa, Oklahoma 74120<br><br> 14002 E 21st Street, Suite 38LL-1, Tulsa Oklahoma 74134<br><br> <b>Claremore Office Location:</b><br><br> 507 E Will Rogers Blvd. Claremore, Oklahoma 74017<br><br> <b>Walk-ins always welcome!</b><br><br> $50 advance available after your first day of work<br><br> Alternatively: You may submit your resume to: ...@standbypersonnel.com<br><br> <b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work.</b>"', 'post_date' => '2024-05-12T00:25:12Z' ) ), (int) 35 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=706ced2a504c73edd2e7de0a1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ApNJumapE7wSRGwC8%253AFOkauSG0B%252FRtLxgH%252BqdOBg%253D%253D%253AoOjjcFIkjYJEv1Qbi%252Flp3QX9I6wkDIQhc1tZKdfVHW%252B0bjDX9xHH02PaZaAr3tCpm%252B4%252FDYNYEKd6GLtrlOezqOb0Dq%252BMiHrQm9KSt6KuoorQe4gRtme6eMe15XAr%252F%252FZZ6Id8Kj4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974918/', 'title' => 'Structural Welder/Fitter', 'description' => '<b>Structural Welder/Fitter</b><br><br> <b>Pay:</b> $20-25/hr.<br><br> <b>Hours:</b> Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Tulsa, Oklahoma<br><br> <b>Weld Tests:</b> Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted up - Test will be shot per code. Must carbon arc back then fill and cap with the same 3G Position.<br><br> <b>Benefits:</b> Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional development opportunities.<br><br> <b>Job Description:</b><br><br> Must have previous experience or ability to work with I-beam size ranges from 6 x 25 to 12 x 50\\. Finished units' range in envelope sizes from 8' x 20' to 16' x 50'. Must be able to read blueprints / drawings / general weld procedures. Structural Fitters take an open book written test. Overhead crane and forklift operations required. (AWS D1:1)<br><br> <b>Job Order # 114695</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br><b>Follow us on Facebook</b> [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-12T00:25:10Z' ) ), (int) 36 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Claremore', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=711981a5218c73edc5b116fd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Aw9bR02i4qs%252BI05cV%253AvVbQ1fJBCscpzvkGP%252BucBw%253D%253D%253AAVLr3B8E37kd4AyTcU6Lu2gDd5roM%252FHz%252F2H8niE%252BEaDGxNGqTfdlopDTyoork7Yvh8jbhRKsh5ECErUfcohgWNH851iWwpx9EzpRuA3GnHmmUwXhCCcJxuLzlsxPLZ5tgZ2u6m0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30357938163/', 'title' => 'Mill Machinist', 'description' => '<p>This job was posted by : For more information, please see: Machinist Pay: \$19/hr +. DOE Hours: Friday- Sunday 6AM-4PM OR 5PM- 3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Will set up and operate planner type milling machine that moves work piece back and forth against rigidly held rotating cutters to mill work pieces. Study blueprints or layout on work piece to determine machine set up, and sequence of machining operations. Lift work piece manually or with an overhead crane to position on machine bed. Secure work piece in holding fixture and verifies position. Ability to operate pneumatic and electric 4 and 9 grinders Safely and Efficiently. Ability to operate pneumatic, cordless impacts. High School Diploma or General Education degree (GED) preferred. Prior experience preferred, but not required. Job Order #117304Stand-By Personnel \| Skilled Division Application Time: 7:00 A.M. to 3:00P.M. Monday-Friday Tulsa Office Locations: 4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146 1531 East 2nd Street Tulsa, Oklahoma 74120 14002 E 21stStreet, Suite 38LL-1, Tulsa Oklahoma 74134 6321 E Admiral Place, Tulsa, Oklahoma 74115 Claremore Office Location: 507 E Will Rogers Blvd. Claremore, Oklahoma 74017 Walk-ins always welcome! \$50 advance available after your first day of work Alternatively: You may submit your resume to: Referral Bonus: \$125 for referring a Skilled Division employee and \$200 for referring a Welding Division/CNC Machinist after 80 hours of work.</p>', 'post_date' => '2024-05-19T18:20:26Z' ) ), (int) 37 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b1ed8c73ec2a5117b11&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkIBNfVGSyi0PK93e%253AHF9G5NNfQ7MTl71W8%252BuFYw%253D%253D%253Ats3Wym383tMnA35y9WUonagdwsEUpT%252FL7a4zgThNgHl8eqrxuakAzHVYqfJUmY63eIp10oJBdj%252BMIEb%252FeqGA%252BOhlpPd%252BEa1cPm%252FtfOgyH%252BxPmH3xVjdv1jc5gpCW2%252BYY2zby6pHVzlLgyROgju0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074111/', 'title' => 'Structural Fitter / Welder', 'description' => '<b>Structural Fitter / Welder</b><br><br> <b>Pay:</b> $21-23/hr.<br><br> <b>Hours:</b> Monday- Friday 6AM-4:30PM<br><br> <b>Job Type:</b>Temp-Hire<br><br> <b>Location:</b> Tulsa, Ok<br><br> <b>Benefits:</b> 401k, 401k Matching, Dental insurance, Health insurance, Paid time off and Vision insurance.<br><br> <b>Job Description:</b><br><br> Must pass an Mig and flux core 3G weld test on a one-inch plate. Experience laying multiple passes with flux core wire feed. Will be frequently lifting, carrying, pushing and pulling up to 50 pounds of material Frequently walking, stooping, kneeling, reaching, and climbing Frequent use of basic hand and measurement tools. Mig, Fluxcore - Stainless Steel, Carbon and Aluminum.<br><br> <b>Job Order # 116486</b><br><br> <b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:30pm, Monday-Friday.<br><br> Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br> Send your resume to ...@standbypersonnel.com<br><br> <b>Follow us on Facebook</b> [<br><br> Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br> Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:57Z' ) ), (int) 38 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=716a7a270c3c73edc28eaedf1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AaPHDSfz98BsWOgym%253Alc8qUXizzfKBqxYfJhJzYg%253D%253D%253AwvujnOri15OW6Bdv%252FiMTkWglJo1i9%252FoubCufQIXkV%252B2BHFn1YFQMljYCu6QBY1IQ5O35GEPA8QWmCJCx9yVcbCb4snG9PVDaow%252FMHOWCYMNgUMRLn2wGxiqUzpamPUVjyz3UjyI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30442842129/', 'title' => 'Structural Welder - Referral Bonus Available', 'description' => '<b>Structural Welder</b><br><br> <b>Pay:</b> $26-27/hr.<br><br> <b>Hours:</b> 5AM-4:30PM OR 5PM-4:30AM<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> North Owasso, Oklahoma<br><br> <b>Job Description:</b><br><br> The Structural Welder performs welding tasks accurately and efficiently to meet project deadlines and quality expectations. Work autonomously with minimal supervision, demonstrating self-drive and productivity. Collaborate effectively with team members to achieve company goals. Identify and rectify subpar welds to maintain product quality standards. Maintain excellent punctuality, reliability, and flexibility to work beyond regular hours when required. Be adaptable to various roles within the plant to support overall operations.<br><br> <b>Qualifications:</b><br><br>* Minimum 2 years of experience in shop fabrication and structural welding.<br>* Proficient in GMAW and FCAW welding processes.<br>* Must be able to interpret technical drawings and prints.<br>* Strong work ethic, reliability, and willingness to collaborate in a team environment.<br><br> <b>Job Order #118125</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-15T00:17:48Z' ) ), (int) 39 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b1cf8c73ec2a5117b31&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AH5foOXMA274ovXdr%253A1jQat9vy0nXapFnVgAKrNQ%253D%253D%253AoNhOgbXB9rZtJJuSruKD4X8lvy3Dw5sH%252BWqyYuox6INl%252BlI0t6SwLwkJbbuKop0YfQD6yRQjPAS66ufl78t7Iow1ktXU48y5FWQj7C0ZYAm4Fv1T7oZk0EV%252Br2WKxEJLZDqjiUCZfvxrDBmY%252FtI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074109/', 'title' => 'Structural Welder', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $22+/hr.<br><br><b>Hours:</b> Monday- Friday 5:30PM-3AM<br><br><b>Job Type:</b> Temp-Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br> <b>Weld Test:</b> Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience)<br><br><b>Job Description:</b><br><br>Ability to weld fabricated parts of structural metal products in shop, plan sequence of operation and meet quality standards. Obtain specified electrode and inserts electrode into portable holder or threads consumable electrode wire through portable welding gun; connect cables from welding unit to obtain amperage, voltage, slope, and pulse, as specified by Welding Engineer or Welding Technician and be able to set welding machine wire feed and read blueprints. Must have 2 years Tig welding experience.<br><br><b>Job Order # 117365</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br><b>You can apply online at</b><br><br> [www.standbypersonnel.com](<br><br><b>Send your resume to</b> <br><br>...@standbypersonnel.com<br><br><b>Follow us on Facebook</b><br><br>[ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:55Z' ) ), (int) 40 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=7162da8dbd3c73edc204a4741&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASQ5%252FOayUGwJWXTWA%253AOsFMyA4hmoPoOd3QQ2tDcA%253D%253D%253AXEjaL2EPN%252FYYCSYWgaui3uiBt%252BFo0V0rdLqhwyBjcdFkBAVMD%252FXhs3CJYaLU%252B4hIAH0V0ZEwwJJolKW5RUSHSFrDi%252F%252BjLljmW4AlXIcl5B57GtDC6Q9a0KTOYoUZB78tkfKCjaoCwDTJiT%252FZbKQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848380/', 'title' => 'Structural Welder', 'description' => '<b>Structural Welder</b><br><br><b>Pay:</b> $22+/hr. (Based on experience)<br><br><b>Hours:</b> Monday- Friday Day and Night shift<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G and 3G Weld Test<br><br><b>Job Description:</b><br><br>The role requires proficiency in welding fabricated parts of structural metal products within a shop environment, ensuring adherence to quality standards. Candidates must be adept at planning the sequence of operations to meet project requirements. This entails obtaining specified electrodes and correctly inserting them into portable holders or threading consumable electrode wire through portable welding guns. Additionally, they must connect cables from welding units to obtain the specified amperage, voltage, slope, and pulse settings, as directed by the Welding Engineer or Welding Technician. The ability to set welding machine wire feed and interpret blueprints accurately is essential. <b>A minimum of 2 years of experience as a Fitter Welder is required for this position.</b><br><br><b>Job Order #118585</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-14T00:22:06Z' ) ), (int) 41 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=703081ae038c73edd721164f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ADWA%252Bh4yQ%252BmIRx%252BVR%253A0Ibmg5FvRoCgTyC0Hg%252FDrw%253D%253D%253AmbP5aXQbJKIABIma4%252BYuu5JncUt1Yhfs63mlrWZi%252BbXUJ3JjwZrB0B45FeqvRxLnhtkKQVaWq4%252FzsfnA05yXLjXdwB8HfhKtlyc201DbjTWwlAihsxoRKik2zFA5me0ink%252B9Aw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30113620097/', 'title' => 'Structural Welder', 'description' => '<b>Structural Welder</b><br><br> <b>Pay:</b> $18-22/hr.<br><br> <b>Hours:</b> 6AM-4:30PM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Owasso, Oklahoma<br><br> <b>Weld Test:</b> 3G and 4G Mig Flux Core<br><br> <b>Job Description:</b><br><br> As a Structural Welder with 3G and 4G, you will play a crucial role in the fabrication and assembly of various structural components. Your primary responsibility will be to perform welding operations according to blueprints, specifications, and welding procedures to ensure the structural integrity and quality of the welded components.<br><br> <b>Job Order # 113965</b><br><br><b>Stand-By Personnel</b> <b>Welding Division</b><br><br>1531 East 2nd Street, Tulsa, Oklahoma 74120 <br>Application Time: 7:00am to 3:30pm, Monday-Friday<br><br>(Walk-In's Welcome)<br><br><b>$50 Advance after your first day of work!</b><br><br><b>Referral Bonus: $125 for referring a Skilled Division employee and $200 for referring a Welding Division/CNC Machinist after 80 hours of work!</b><br><br><b>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility.</b><br><br>"', 'post_date' => '2024-05-18T00:19:13Z' ) ), (int) 42 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=714ec5fb43cc73edc0c5531b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AeSaUPeke5UUA17s0%253ADIjsOaICftxfpUaB9iZYXg%253D%253D%253AmRzC8B5hSS2b4Rm62gxpBerlPlB0oKVYPRdt9E3DI91aKuWJJZGAYL630QAzWwuVzAOKv%252FxEljBJ%252FtbcWXVW%252BRiKUZM80d1suovtzqN%252B%252F4Y63BmKFoOUN2DCsHp%252FcXzQfMlbysGkHOc4dCEDqp0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792597/', 'title' => 'Structural Steel Fitters/Mig Flux Welder', 'description' => '<b>Structural Steel Fitters/Mig Flux Welder</b><br><br><b>Pay:</b> $18+/hr.<br><br><b>Hours:</b> Monday-Friday 5AM-3:30PM<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Tulsa, Oklahoma<br><br><b>Test:</b> 3G Weld test<br><br><b>Job Description:</b><br><br>We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating and assembling metal structures and components using various welding techniques. This role requires precision, attention to detail, and the ability to work with various materials in accordance with engineering specifications and safety standards.<br><br>Candidate required to supply 12" adjustable wrench, 25' tape measure, and a ball peen or shop hammer not a nail driving claw type hammer. <br><br><b>Job Order #118568</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-11T00:12:43Z' ) ), (int) 43 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=717d83a3fcac73edc3f136901&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5KFz4bmsYr7PM%252FQh%253AYs9vX2wQqYXMW%252Bml2OqTrw%253D%253D%253AKL62fk%252Ft2AVigBcKVeBRPmQBqTTS%252F4dpzbOltxQSs%252B4hj4bCoro08huZBG5o1vWxVnsQE5gCT9I5NQjGC4sJT2wbvpgHPwc3xklquuk%252Bh4e4UZuIAGqNxlmtzBT5OSVsEuk0Pyk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803936/', 'title' => 'Robotic Welder - $25 - 30/hr', 'description' => '<b>Robotic Welder</b><br><br><b>Pay:</b> $25-30/hr.<br><br><b>Hours:</b> Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks)<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G Pulse MIG on ½ inch plate<br><br><b>Job Description:</b><br><br>The Robotic Welder Operator is responsible for setting up and operating computer-controlled machines or robots to perform various functions on steel products. This role requires strict adherence to all safety requirements and protocols. The operator will apply welding competencies and utilize computer-based software to control the robotic machines. Responsibilities include interpreting and performing welding techniques to fabricate parts for product manufacturing. The operator must be able to read and interpret blueprints, planning sheets, sketches, and related technical data to determine tooling requirements, setup procedures, control settings, welding methods, and sequences.<br><br>Key tasks involve mounting, aligning, and securing tooling, attachments, and workpieces on machines using an overhead crane. The operator must ensure proper setup, interpret and verify the correctness of programs used on the machine, and measure workpieces for conformance to specifications. The role also requires entering commands or manually adjusting machine controls to correct malfunctions or out-of-tolerance machining and operating the machine manually when automatic programming is faulty or the machine malfunctions.<br><br><b>Requirements:</b><br><br><b>Minimum two years related experience or training.</b><br><br><b>Job Order #118603</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-17T00:19:24Z' ) ), (int) 44 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b1128c73ec2a5117be1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AifDibtNGqltWkVK%252F%253AkvUWBtBvuRdFOPxl1oMYRQ%253D%253D%253AWSELE4uQbhVtdvteOOvY7FHnCty%252FHgR69ndr6vVPMoB8coSnnO6336PwS8xX8nlb11ove1dq%252BZLUyn99RQeJWMw4OQC7fuy9xQS6qHCWi%252FUtc4vHdq%252B8Ul1mJ0%252FHImiNRHs8oCM%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074098/', 'title' => 'Structural Fitter / Welder', 'description' => '<b>Weekend Structural Fitter Welder</b><br><br> <b>Pay:</b> $25+/hr.<br><br> <b>Hours:</b> Friday-Sunday 5:30PM-5AM (Work 36, paid 40)<br><br> <b>Job Type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Job Description:</b><br><br> Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms. Proficiency in blueprint reading for layout is required. Will be responsible for selecting equipment, planning layout, assembly, and welding. Tasks include positioning, aligning, and fitting components, as well as using tools like tape measure, square, combination square, level, and others for part fabrication according to blueprints. Simple mathematical calculations are needed to find part dimensions. The role involves performing 100% first article inspections, setting up welding machines, and operating cutting and plasma torches, as well as small saw and iron machines. Repairs involve dismantling, straightening, reshaping, and reassembling parts. Forklift operation is advantageous. The person should be able to identify and select different types of materials, operate various power tools, and load trucks manually. Other requirements include regular attendance, punctuality, ability to work cooperatively, and passing the American Welding Society 2g Plate Test/ Welding Bureau certification. One year of structural fitting experience is recommended.<br><br> <b>Job Order #118020</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:51Z' ) ), (int) 45 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=717d83a48bac73edc3f136e71&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AHHeQb4e1NYA5w0M5%253AHIz1sL7apzB1LWU4xhrd8g%253D%253D%253AX5FD99ly3Cz0lKc1sTtEN6KsvPTtss6zDXxyEzTxcFG9s8WW%252Bj8EKBKma2vwcvReGVHyp3FQlg7iecerB1tGlgTun%252FO%252B%252FD2WrhUQ%252FCVeOX58VHWEIuyup0LxoOXY9qGl1r7Zkv0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803945/', 'title' => 'Traveling Field Service Fitter Welder - $28 - 30/hr', 'description' => '<b>Traveling Field Service / Fitter Welder</b><br><br><b>Pay:</b> $28-30/hr.<br><br><b>Hours:</b> Varies<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Oklahoma, Kansas, Arkansas<br><br><b>Test:</b> Must be able to pass a 3G and 6G weld test<br><br><b>Must be able and willing to travel state to state.</b><br><br><b>Job Description:</b><br><br>We are seeking a Traveling Field Service / Fitter Welder! The ideal candidate will be responsible for a variety of tasks, including the demolition of equipment to be replaced and assisting with daily activities under supervision. This role requires active participation in the preparation and readiness of parts and tools for fit-up and welding activities, both before and after these tasks are performed.<br><br>The Welder should have a comprehensive understanding of departmental operating procedures, job task procedures, and ASME code requirements for all vessel-related jobs is essential. Must be proficient in welding processes such as FCAW, GMAW, and GTAW, and must pass 3G and 6G welding tests as directed by the departmental foreman.<br><br>Responsibilities also include interpreting blueprints accurately, performing hydrostatic testing of boiler systems and field-installed piping according to applicable codes, and making necessary repairs to boilers and associated systems as required or directed by the service manager. The candidate will be accountable for maintaining quality and continuous improvement within the job scope and fulfilling all tasks and responsibilities assigned by the departmental foreman.<br><br><b>Requirements:</b><br><br>* Ability to travel regularly across states.<br>* Proficiency in following both written and verbal instructions.<br>* Some experience in field services or boiler installation functions.<br>* Strong mathematical skills.<br>* Proficiency in using various hand tools, both powered and manual.<br>* ASME code certification in welding processes (FCAW, GMAW, GTAW).<br>* Complete knowledge of blueprint interpretation.<br>* Flexibility to work any shift as needed.<br><br><b>Job Order #118602</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-17T00:19:25Z' ) ), (int) 46 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=717d83a49aac73edc3f136e61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7sHzBVBSeVP7nTLL%253AnOE%252BSijuJf7tRMWb6%252FjeZg%253D%253D%253Am0HIinDyjJI2yv1krBAUjYG22ctIljvdOcxpN0Dab2F4Gm%252F6nptIeek7VnKrnNSBQSMy%252BVxQuIGu%252FGj60jrqmoJafint94vHNQCoo%252BI9ApuqBJ0tQfKG329blwzqOGvAjMYtq6A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803946/', 'title' => 'Traveling Field Service Fitter Welder - Referral Bonus Available', 'description' => '<b>Traveling Field Service / Fitter Welder</b><br><br><b>Pay:</b> $28-30/hr.<br><br><b>Hours:</b> Varies<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Oklahoma, Kansas, Arkansas<br><br><b>Test:</b> Must be able to pass a 3G and 6G weld test<br><br><b>Must be able and willing to travel state to state.</b><br><br><b>Job Description:</b><br><br>We are seeking a Traveling Field Service / Fitter Welder! The ideal candidate will be responsible for a variety of tasks, including the demolition of equipment to be replaced and assisting with daily activities under supervision. This role requires active participation in the preparation and readiness of parts and tools for fit-up and welding activities, both before and after these tasks are performed.<br><br>The Welder should have a comprehensive understanding of departmental operating procedures, job task procedures, and ASME code requirements for all vessel-related jobs is essential. Must be proficient in welding processes such as FCAW, GMAW, and GTAW, and must pass 3G and 6G welding tests as directed by the departmental foreman.<br><br>Responsibilities also include interpreting blueprints accurately, performing hydrostatic testing of boiler systems and field-installed piping according to applicable codes, and making necessary repairs to boilers and associated systems as required or directed by the service manager. The candidate will be accountable for maintaining quality and continuous improvement within the job scope and fulfilling all tasks and responsibilities assigned by the departmental foreman.<br><br><b>Requirements:</b><br><br>* Ability to travel regularly across states.<br>* Proficiency in following both written and verbal instructions.<br>* Some experience in field services or boiler installation functions.<br>* Strong mathematical skills.<br>* Proficiency in using various hand tools, both powered and manual.<br>* ASME code certification in welding processes (FCAW, GMAW, GTAW).<br>* Complete knowledge of blueprint interpretation.<br>* Flexibility to work any shift as needed.<br><br><b>Job Order #118602</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-17T00:19:25Z' ) ), (int) 47 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=717d83a430ac73edc3f136ec1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AI4hYNPXrYO8Yx2Rz%253AcjyY9QBAjBKEdOZv0ycSZQ%253D%253D%253Au05shHupWvXq5vg%252BcsTX8yfNTKto%252BxfuPlBA70MUdXHnQcGBaxwsLVdM%252FQ5gN0iq%252BNPPgZxp5nfkEohNFYGf%252FoEBDCy84FlySWo3qj9WwCvoN9KVEjawnwn%252BkWLXHV5S6Le9Px4jiTGTr1r7Lvs%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803940/', 'title' => 'Robotic Welder - Referral Bonus Available', 'description' => '<b>Robotic Welder</b><br><br><b>Pay:</b> $25-30/hr.<br><br><b>Hours:</b> Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks)<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G Pulse MIG on ½ inch plate<br><br><b>Job Description:</b><br><br>The Robotic Welder Operator is responsible for setting up and operating computer-controlled machines or robots to perform various functions on steel products. This role requires strict adherence to all safety requirements and protocols. The operator will apply welding competencies and utilize computer-based software to control the robotic machines. Responsibilities include interpreting and performing welding techniques to fabricate parts for product manufacturing. The operator must be able to read and interpret blueprints, planning sheets, sketches, and related technical data to determine tooling requirements, setup procedures, control settings, welding methods, and sequences.<br><br>Key tasks involve mounting, aligning, and securing tooling, attachments, and workpieces on machines using an overhead crane. The operator must ensure proper setup, interpret and verify the correctness of programs used on the machine, and measure workpieces for conformance to specifications. The role also requires entering commands or manually adjusting machine controls to correct malfunctions or out-of-tolerance machining and operating the machine manually when automatic programming is faulty or the machine malfunctions.<br><br><b>Requirements:</b><br><br><b>Minimum two years related experience or training.</b><br><br><b>Job Order #118603</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-17T00:19:25Z' ) ), (int) 48 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Claremore', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=716965f4a7cc73edc2bf53e51&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Ao31GVH5Y1fnzcsYf%253AWweuknErSVWaJeIeeWWedQ%253D%253D%253AB3D82UqOnqddkUOgFb3eOOW4XXtJleToleG1kGWFHqLe1gu2MjzqC%252BXvgB2AdQviI1YAWOjYIv1SlyV5GKYWPswqkXPWQOH3bE54NI%252BSAIuQ1O6u5pCiixXLJROfiddv9QecD9PekG6IkZuqMg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30441710827/', 'title' => 'Powder Coating Painter', 'description' => '<p>This job was posted by : For more information, please see: Coating Painter Pay: \$18-19/hr. Hours: Monday-Friday Day Shift Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Abrades surfaces of metal or hard composition objects to remove adhering scale, sand, paint, grease, tar, rust, and dirt, and to impart specified finish. Shovel or pour abrasives such as sand, grit, or shot of specified grade into machine hopper. Select premixed paints, or mixes required portions of pigment, oil, and thinning and drying substances to prepare paint that matches specified colors. Ability to prep product prior/ post painting. Must be able to use a power spray gun. Must pass Pulmonary Function Test (PFT); must be fitted and be able to wear respirator. Physically active & must be able to lift to 50 lbs. Job Order #117296Stand-By Personnel \| Skilled Division Application Time: 7:00 A.M. to 3:00P.M. Monday-Friday Tulsa Office Locations: 1531 E 2nd Street Tulsa, Oklahoma 74120 4305 S Mingo Road, Suite F, Tulsa, Oklahoma 74146 14002 E 21stStreet, Suite 38LL-1, Tulsa Oklahoma 74134 6321 E Admiral Place, Tulsa, Oklahoma 74115 Claremore Office Location: 507 E Will Rogers Blvd. Claremore, Oklahoma 74017 Walk-ins always welcome! \$50 advance available after your first day of work Alternatively: You may submit your resume to: Referral Bonus: \$125 for referring a Skilled Division employee and \$200 for referring a Welding Division/CNC Machinist after 80 hours of work.</p>', 'post_date' => '2024-05-19T18:22:28Z' ) ), (int) 49 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=717d83a3deac73edc3f136921&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkW5UHUyHsc3ZavSI%253AOMGEzOeKhLqR7ALPqybvTg%253D%253D%253AJt%252B6Q5tp99C3Yd3t7x6DJ%252BmiTtERHMoNWV0SKq9u%252F292xEv0R6jxcAYbCd3l9yN1iRlpy1%252BWGEGxrIqYD4dAnYv6AY8yvdNUqYCtQr6DeU6vfdtyaSFtizEBHraF4dLIUUR0dw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803934/', 'title' => 'Robotic Welder', 'description' => '<b>Robotic Welder</b><br><br><b>Pay:</b> $25-30/hr.<br><br><b>Hours:</b> Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks)<br><br><b>Job Type:</b> Temp to Hire<br><br><b>Location:</b> Catoosa, Oklahoma<br><br><b>Test:</b> 2G Pulse MIG on ½ inch plate<br><br><b>Job Description:</b><br><br>The Robotic Welder Operator is responsible for setting up and operating computer-controlled machines or robots to perform various functions on steel products. This role requires strict adherence to all safety requirements and protocols. The operator will apply welding competencies and utilize computer-based software to control the robotic machines. Responsibilities include interpreting and performing welding techniques to fabricate parts for product manufacturing. The operator must be able to read and interpret blueprints, planning sheets, sketches, and related technical data to determine tooling requirements, setup procedures, control settings, welding methods, and sequences.<br><br>Key tasks involve mounting, aligning, and securing tooling, attachments, and workpieces on machines using an overhead crane. The operator must ensure proper setup, interpret and verify the correctness of programs used on the machine, and measure workpieces for conformance to specifications. The role also requires entering commands or manually adjusting machine controls to correct malfunctions or out-of-tolerance machining and operating the machine manually when automatic programming is faulty or the machine malfunctions.<br><br><b>Requirements:</b><br><br><b>Minimum two years related experience or training.</b><br><br><b>Job Order #118603</b><br><br><b>Stand-By Personnel Welding Division</b><br><br>We take walk-in applications from 7:00am to 3:00pm, Monday-Friday.<br><br>Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br>You can apply online at [www.standbypersonnel.com](<br><br>Send your resume to ...@standbypersonnel.com<br><br>Follow us on Facebook [ <br><br><b>Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.</b><br><br>Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-17T00:19:24Z' ) ), (int) 50 => array( 'Employer' => array( 'company_name' => 'Stand-By Personnel' ), 'UtZipcode' => array( 'city' => 'Tulsa', 'state_prefix' => 'OK' ), 'User' => array( 'unique_name' => '' ), 'EmployersJob' => array( 'anonymous_post' => (int) 0, 'open' => (int) 1, 'url' => 'https://www.jobs2careers.com/click.php?jid=6fe781b2b88c73ec2a5117841&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ArAEKL5tsicrJ%252BUYn%253Ay6zCf%252FWjGVpPp8eoEuGCYA%253D%253D%253A7JXd%252BlrtAAU9OErOfOMLdBMy4a8ARroAEHPooAYKMjtSbA5MjVvMkdsxuBhpplPgEOiLdrAvtV6x9IR8LOY5LiqMXD8VUUk7V907566wGzBNFh9m4CpGEzaxePZP02Mlv5duAIQ1PaIYLYpAQrs4&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074124/', 'title' => 'Header Sub Arc/ Lance Operator', 'description' => '<b>Header Sub Arc/ Lance Operator</b><br><br> <b>Pay:</b> $19+/hr. (Depending on experience)<br><br> <b>Hours:</b> 5PM-5:30AM<br><br> <b>Job type:</b> Temp to Hire<br><br> <b>Location:</b> Catoosa, Oklahoma<br><br> <b>Weld Test:</b> 1G Saw Plate Sub-Arc and 2G Plate Test (3years of experience required)<br><br> <b>Job Description:</b><br><br> The ideal candidate will possess the ability to weld trunnion to the end of headers and expertly position headers using overhead or jib cranes. They will demonstrate proficiency in aligning electrodes on welding heads over weld joints, loading reels of electrode wire onto machines, and threading electrode wire through feed rolls with precision. Additionally, the candidate should be adept at filling hoppers with specified flux and directing nozzles or gravity feed over weld lines. Operates welding equipment requires the ability to set current, voltage, and slope, while synchronizing wire and flux feed with welding speed. Monitoring meters, gauges, or welding actions for procedural compliance is essential. The candidate must also visually inspect welds for adherence to specifications and perform grinding on welded surfaces as needed. Adjusting machine setups to vary bead size, location, and penetration, as well as laying out, fitting, and tacking workpieces together, are integral aspects of the role. Preheating workpieces using hand torches or heating furnaces and removing surplus slag, flux, and spatter are also part of the responsibilities. If necessary, the candidate should be capable of removing metal using a carbon arc gouger to make repairs.<br><br> <b>Job Order # 115771</b><br><br> <b>Stand-By Personnel Welding Division</b><br><br> We take walk-in applications from 7:00am to 3:30pm, Monday-Friday.<br><br> Office Location: 1531 East 2nd Street Tulsa, Oklahoma 74120, near the corner of Hwy 244 East and Utica.<br><br> You can apply online at [www.standbypersonnel.com](<br><br> Send your resume to ...@standbypersonnel.com<br><br> Follow us on Facebook [ <br><br> Stand-By Personnel offers very competitive referral bonuses -- $125 for a skilled worker, and $200 for a welder. We also offer a $50.00 advance after your first day of work.<br><br> Stand-By Personnel's Welding Division is a proven leader when it comes finding welders jobs. Stand-By staff's welders for many of the top companies in Oklahoma. Stand-By is the only staffing company that offers weld testing and has an onsite State Certified Weld Testing Facility."', 'post_date' => '2024-05-09T00:26:59Z' ) ) ) $search_text = '' $sort_by = 'relevance' $page = '10' $location_details = array( 'id' => '367', 'name' => 'Northwest OK', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'lat' => '35.9420', 'lon' => '-95.8833', 'background_class' => 'generic-panel', 'key_value' => 'northwest OK', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9', 'created_date' => '2018-10-26 16:58:52', 'posting_fee' => '10.0000', 'city' => 'northwest OK' ) $all_locations = array( 'abilene' => array( 'name' => 'Monroe', 'city' => 'monroe', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.5093', 'lon' => '-92.1193', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'abilene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'akron / canton' => array( 'name' => 'Akron / Canton', 'city' => 'akron / canton', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.0814', 'lon' => '-81.5190', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'akron / canton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'albany' => array( 'name' => 'Albany', 'city' => 'albany', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5785', 'lon' => '-84.1557', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'albany', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'albuquerque' => array( 'name' => 'Albuquerque', 'city' => 'albuquerque', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.0844', 'lon' => '-106.6504', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'albuquerque', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'allentown' => array( 'name' => 'Allentown', 'city' => 'Allentown', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '40.6017', 'lon' => '-75.4772', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'allentown', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'altoona-johnstown' => array( 'name' => 'Altoona-Johnstown', 'city' => 'altoona-johnstown', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.5187', 'lon' => '-78.3947', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'altoona-johnstown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'amarillo' => array( 'name' => 'Amarillo', 'city' => 'amarillo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '35.1992', 'lon' => '-101.8453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'amarillo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ames' => array( 'name' => 'Ames', 'city' => 'ames', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0308', 'lon' => '-93.6319', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ames', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'anchorage / mat-su' => array( 'name' => 'Anchorage / Mat-su', 'city' => 'anchorage / mat-su', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '61.2167', 'lon' => '149.9000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'anchorage / mat-su', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ann arbor' => array( 'name' => 'Ann Arbor', 'city' => 'ann arbor', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.2814', 'lon' => '-83.7483', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ann arbor', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'annapolis' => array( 'name' => 'Annapolis', 'city' => 'Annapolis', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '38.9729', 'lon' => '-76.5012', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'annapolis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'appleton-oshkosh-FDL' => array( 'name' => 'Appleton-Oshkosh-FDL', 'city' => 'appleton-oshkosh-FDL', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.2667', 'lon' => '-88.4000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'appleton-oshkosh-FDL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'asheville' => array( 'name' => 'Asheville', 'city' => 'asheville', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.5800', 'lon' => '82.5558', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'asheville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ashtabula' => array( 'name' => 'Ashtabula', 'city' => 'ashtabula', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8651', 'lon' => '-80.7898', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ashtabula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'athens' => array( 'name' => 'Athens', 'city' => 'athens', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3292', 'lon' => '-82.1013', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'athens', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'atlanta' => array( 'name' => 'Atlanta', 'city' => 'atlanta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '33.7490', 'lon' => '-84.3900', 'background-class' => 'atlanta-panel', 'background_class' => 'atlanta-panel', 'key_value' => 'atlanta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'auburn' => array( 'name' => 'Auburn', 'city' => 'auburn', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.6099', 'lon' => '85.4808', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'auburn', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'augusta' => array( 'name' => 'Augusta', 'city' => 'augusta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '33.4735', 'lon' => '-82.0105', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'augusta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'austin' => array( 'name' => 'Austin', 'city' => 'Austin', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '30.2672', 'lon' => '-97.7431', 'background-class' => 'austin-panel', 'background_class' => 'austin-panel', 'key_value' => 'austin', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'bakersfield' => array( 'name' => 'Bakersfield', 'city' => 'bakersfield', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.3667', 'lon' => '-119.0167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bakersfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'baltimore' => array( 'name' => 'Baltimore', 'city' => 'Baltimore', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.2833', 'lon' => '-76.6167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'baltimore', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'baton rouge' => array( 'name' => 'Baton Rouge', 'city' => 'baton rouge', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '30.4500', 'lon' => '-91.1400', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'baton rouge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'battle creek' => array( 'name' => 'Battle Creek', 'city' => 'battle creek', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.3212', 'lon' => '-85.1797', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'battle creek', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'beaumont / port arthur' => array( 'name' => 'Beaumont / Port Arthur', 'city' => 'beaumont / port arthur', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.0013', 'lon' => '-94.1514', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'beaumont / port arthur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bellingham' => array( 'name' => 'Bellingham', 'city' => 'bellingham', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '48.7491', 'lon' => '-122.4781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bellingham', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bemidji' => array( 'name' => 'Bemidji', 'city' => 'bemidji', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4716', 'lon' => '-94.8827', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bemidji', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bend' => array( 'name' => 'Bend', 'city' => 'bend', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.0582', 'lon' => '-121.3153', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bend', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'billings' => array( 'name' => 'Billings', 'city' => 'billings', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '45.7833', 'lon' => '-108.5007', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'billings', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'binghamton' => array( 'name' => 'Binghamton', 'city' => 'binghamton', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.0987', 'lon' => '-75.9180', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'binghamton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'birmingham' => array( 'name' => 'Birmingham', 'city' => 'birmingham', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '33.5250', 'lon' => '86.8130', 'background-class' => 'general-panel', 'background_class' => 'general-panel', 'key_value' => 'birmingham', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bismarck' => array( 'name' => 'Bismarck', 'city' => 'bismarck', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.9812', 'lon' => '-100.7003', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bismarck', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bloomington' => array( 'name' => 'Bloomington', 'city' => 'bloomington', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.1653', 'lon' => '-86.5264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bloomington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bloomington-normal' => array( 'name' => 'Bloomington–Normal', 'city' => 'bloomington-normal', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4842', 'lon' => '-88.9937', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bloomington-normal', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boise' => array( 'name' => 'Boise', 'city' => 'Boise', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.6167', 'lon' => '-116.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boise', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boone' => array( 'name' => 'Boone', 'city' => 'boone', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.2114', 'lon' => '-81.6686', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boone', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'boston' => array( 'name' => 'Boston', 'city' => 'Boston', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '42.3581', 'lon' => '-71.0389', 'background-class' => 'boston-panel', 'background_class' => 'boston-panel', 'key_value' => 'boston', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'boulder' => array( 'name' => 'Boulder', 'city' => 'boulder', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.0274', 'lon' => '-105.2519', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'boulder', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bowling green' => array( 'name' => 'Bowling Green', 'city' => 'bowling green', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.9685', 'lon' => '-86.4808', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bowling green', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'bozeman' => array( 'name' => 'Bozeman', 'city' => 'bozeman', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '45.6770', 'lon' => '-111.0429', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'bozeman', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brainerd' => array( 'name' => 'Brainerd', 'city' => 'brainerd', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.3527', 'lon' => '-94.2020', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brainerd', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brownsville' => array( 'name' => 'Brownsville', 'city' => 'brownsville', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '25.9017', 'lon' => '-97.4975', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brownsville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'brunswick' => array( 'name' => 'Brunswick', 'city' => 'brunswick', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.1500', 'lon' => '-81.4915', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'brunswick', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'buffalo' => array( 'name' => 'Buffalo', 'city' => 'Buffalo', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.9047', 'lon' => '-78.8494', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'buffalo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'butte' => array( 'name' => 'Butte', 'city' => 'butte', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.0038', 'lon' => '-112.5348', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'butte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cape cod / islands' => array( 'name' => 'Cape Cod / Islands', 'city' => 'cape cod / islands', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6800', 'lon' => '-70.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cape cod / islands', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'catskills' => array( 'name' => 'Catskills', 'city' => 'catskills', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2146', 'lon' => '-73.9595', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'catskills', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cedar rapids' => array( 'name' => 'Cedar Rapids', 'city' => 'cedar rapids', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.9779', 'lon' => '-91.6656', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cedar rapids', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central louisiana' => array( 'name' => 'Central Louisiana', 'city' => 'central louisiana', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.5543', 'lon' => '-91.0369', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central louisiana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central michigan' => array( 'name' => 'Central Michigan', 'city' => 'central michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4071', 'lon' => '-88.2007', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'central NJ' => array( 'name' => 'Central NJ', 'city' => 'New Brunswick', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.2237', 'lon' => '-74.7640', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'central NJ', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'champaign urbana' => array( 'name' => 'Champaign Urbana', 'city' => 'champaign urbana', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1164', 'lon' => '-88.2434', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'champaign urbana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charleston' => array( 'name' => 'Charleston', 'city' => 'charleston', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.3498', 'lon' => '-81.6326', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charleston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charlotte' => array( 'name' => 'Charlotte', 'city' => 'charlotte', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '35.2269', 'lon' => '-80.8433', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charlotte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'charlottesville' => array( 'name' => 'Charlottesville', 'city' => 'charlottesville', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.0293', 'lon' => '-38.0293', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'charlottesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chattanooga' => array( 'name' => 'Chattanooga', 'city' => 'chattanooga', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.0456', 'lon' => '-84.2672', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chattanooga', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chautauqua' => array( 'name' => 'Chautauqua', 'city' => 'chautauqua', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2098', 'lon' => '-79.4668', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chautauqua', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chicago' => array( 'name' => 'Chicago', 'city' => 'Chicago', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '41.8781', 'lon' => '-87.6298', 'background-class' => 'chicago-panel', 'background_class' => 'chicago-panel', 'key_value' => 'chicago', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'chico' => array( 'name' => 'Chico', 'city' => 'chico', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.7285', 'lon' => '-121.8375', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chico', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'chillicothe' => array( 'name' => 'Chillicothe ', 'city' => 'chillicothe', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3331', 'lon' => '-82.9824', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'chillicothe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cincinnati' => array( 'name' => 'Cincinnati', 'city' => 'Cincinnati', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.1000', 'lon' => '-84.5167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cincinnati', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'clarksville' => array( 'name' => 'Clarksville', 'city' => 'clarksville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.5298', 'lon' => '-87.3595', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'clarksville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cleveland' => array( 'name' => 'Cleveland', 'city' => 'Cleveland', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.4822', 'lon' => '-81.6697', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cleveland', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'clovis / portales' => array( 'name' => 'Clovis / Portales', 'city' => 'clovis / portales', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.1862', 'lon' => '-103.3344', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'clovis / portales', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'college station' => array( 'name' => 'College Station', 'city' => 'college station', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.6014', 'lon' => '-96.3144', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'college station', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'colorado springs' => array( 'name' => 'Colorado Springs', 'city' => 'Colorado Springs', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.8673', 'lon' => '-104.7607', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'colorado springs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbia' => array( 'name' => 'Columbia', 'city' => 'columbia', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.0298', 'lon' => '-80.8966', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbia', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbia / jeff city' => array( 'name' => 'columbia / jeff city', 'city' => 'columbia / jeff city', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.9517', 'lon' => '-92.3341', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbia / jeff city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'columbus' => array( 'name' => 'Columbus GA', 'city' => 'columbus', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.4610', 'lon' => '-84.9877', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'columbus', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cookeville' => array( 'name' => 'Cookeville', 'city' => 'cookeville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.1628', 'lon' => '-85.5016', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cookeville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'corpus christi' => array( 'name' => 'Corpus Christi', 'city' => 'Corpus Christi', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '27.7428', 'lon' => '-97.4019', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'corpus christi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'corvallis/albany' => array( 'name' => 'Corvallis/Albany', 'city' => 'corvallis/albany', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.9559', 'lon' => '-123.0170', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'corvallis/albany', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'cumberland valley' => array( 'name' => 'Cumberland Valley', 'city' => 'cumberland valley', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1300', 'lon' => '-78.2405', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'cumberland valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dallas / fort worth' => array( 'name' => 'Dallas / Fort Worth', 'city' => 'dallas / fort worth', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '32.7555', 'lon' => '-97.3308', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dallas / fort worth', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'danville' => array( 'name' => 'Danville', 'city' => 'danville', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.5860', 'lon' => '-79.3950', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'danville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dayton / springfield' => array( 'name' => 'Dayton / Springfield', 'city' => 'dayton / springfield', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '39.7594', 'lon' => '-84.1917', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dayton / springfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'daytona beach' => array( 'name' => 'Daytona Beach', 'city' => 'daytona beach', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.1900', 'lon' => '-81.0894', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'daytona beach', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'decatur' => array( 'name' => 'Decatur', 'city' => 'decatur', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.8403', 'lon' => '-88.9548', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'decatur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'deep east texas' => array( 'name' => 'Deep East Texas', 'city' => 'deep east texas', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5263', 'lon' => '-94.0812', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'deep east texas', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'del rio / eagle pass' => array( 'name' => 'Del Rio / Eagle Pass', 'city' => 'del rio / eagle pass', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.7091', 'lon' => '-100.4995', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'del rio / eagle pass', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'delaware' => array( 'name' => 'Delaware', 'city' => 'delaware', 'state' => 'DE', 'state_expanded' => 'Delaware', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.0000', 'lon' => '-75.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'delaware', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'denver' => array( 'name' => 'Denver', 'city' => 'denver', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '39.7376', 'lon' => '-104.9847', 'background-class' => 'denver-panel', 'background_class' => 'denver-panel', 'key_value' => 'denver', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'des moines' => array( 'name' => 'Des Moines', 'city' => 'des moines', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.5908', 'lon' => '-93.6208', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'des moines', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'detroit metro' => array( 'name' => 'Detroit Metro', 'city' => 'detroit metro', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '42.2162', 'lon' => '-83.3554', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'detroit metro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dothan' => array( 'name' => 'Dothan', 'city' => 'dothan', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.2232', 'lon' => '85.3905', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dothan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'dubuque' => array( 'name' => 'Dubuque', 'city' => 'dubuque', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.6958', 'lon' => '-98.6090', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'dubuque', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'duluth / superior' => array( 'name' => 'Duluth / Superior', 'city' => 'duluth / superior', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.7860', 'lon' => '-92.1005', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'duluth / superior', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'east idaho' => array( 'name' => 'East Idaho', 'city' => 'east idaho', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.4916', 'lon' => '-112.0340', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'east idaho', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'east oregon' => array( 'name' => 'East Oregon', 'city' => 'east oregon', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.0266', 'lon' => '-116.9629', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'east oregon', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern CO' => array( 'name' => 'Eastern CO', 'city' => 'eastern CO', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.8605', 'lon' => '-104.7871', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern CO', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern CT' => array( 'name' => 'Eastern CT', 'city' => 'Hartford', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.0511', 'lon' => '-73.4792', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern CT', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern kentucky' => array( 'name' => 'Eastern Kentucky', 'city' => 'eastern kentucky', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.5165', 'lon' => '-82.8067', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern kentucky', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern NC' => array( 'name' => 'Eastern North Carolina', 'city' => 'eastern NC', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '34.6388', 'lon' => '-78.6374', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern NC', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern panhandle' => array( 'name' => 'Eastern Panhandle', 'city' => 'eastern panhandle', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4562', 'lon' => '-77.9639', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eastern shore' => array( 'name' => 'Eastern Shore', 'city' => 'eastern shore', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.2102', 'lon' => '-75.6848', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eastern shore', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eau claire' => array( 'name' => 'Eau Claire', 'city' => 'eau claire', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.8113', 'lon' => '-91.4985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eau claire', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'el paso' => array( 'name' => 'El Paso', 'city' => 'el paso', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '31.7903', 'lon' => '-106.4233', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'el paso', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'elko' => array( 'name' => 'Elko', 'city' => 'elko', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.8324', 'lon' => '-115.7631', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'elko', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'elmira-corning' => array( 'name' => 'Elmira-Corning', 'city' => 'elmira-corning', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0898', 'lon' => '-76.8077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'elmira-corning', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'erie' => array( 'name' => 'Erie', 'city' => 'erie', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.1292', 'lon' => '-80.0851', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'erie', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'eugene' => array( 'name' => 'Eugene', 'city' => 'eugene', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.0519', 'lon' => '-123.0867', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'eugene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'evansville' => array( 'name' => 'Evansville', 'city' => 'evansville', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.9716', 'lon' => '-87.5710', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'evansville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fairbanks' => array( 'name' => 'Fairbanks', 'city' => 'fairbanks', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '64.8378', 'lon' => '147.7164', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fairbanks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new york city' => array( 'name' => 'New York City', 'city' => 'new york city', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '40.7128', 'lon' => '-74.0060', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new york city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fargo / moorhead' => array( 'name' => 'Fargo / Moorhead', 'city' => 'fargo / moorhead', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.8772', 'lon' => '-96.7898', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fargo / moorhead', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'farmington' => array( 'name' => 'Farmington', 'city' => 'farmington', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.7281', 'lon' => '-108.2187', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'farmington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fayetteville AR' => array( 'name' => 'Fayetteville AR', 'city' => 'fayetteville AR', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0764', 'lon' => '-94.1608', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fayetteville AR', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fayetteville NC' => array( 'name' => 'Fayetteville NC', 'city' => 'fayetteville NC', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.0525', 'lon' => '-78.8781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fayetteville NC', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'finger lakes' => array( 'name' => 'Finger Lakes', 'city' => 'finger lakes', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.7238', 'lon' => '-76.9297', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'finger lakes', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'flagstaff / sedona' => array( 'name' => 'Flagstaff / Sedona', 'city' => 'flagstaff / sedona', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.1983', 'lon' => '111.6513', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'flagstaff / sedona', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'flint' => array( 'name' => 'Flint', 'city' => 'flint', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '43.0125', 'lon' => '-83.6875', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'flint', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florence' => array( 'name' => 'Florence', 'city' => 'florence', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.3803', 'lon' => '-79.0753', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florence', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florence / muscle shoals' => array( 'name' => 'Florence / Muscle Shoals', 'city' => 'florence / muscle shoals', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.7998', 'lon' => '87.6773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florence / muscle shoals', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'florida keys' => array( 'name' => 'Florida Keys', 'city' => 'florida keys', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '0', 'cl_posting_fee' => '10', 'lat' => '25.0865', 'lon' => '-80.4473', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'florida keys', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort collins / north CO' => array( 'name' => 'Fort Collins / North CO', 'city' => 'fort collins / north CO', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.5592', 'lon' => '-105.0781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort collins / north CO', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort dodge' => array( 'name' => 'Fort Dodge', 'city' => 'fort dodge', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4975', 'lon' => '-94.1680', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort dodge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort smith' => array( 'name' => 'Fort Smith', 'city' => 'fort smith', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.3859', 'lon' => '94.3985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort smith', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fort wayne' => array( 'name' => 'Fort Wayne', 'city' => 'fort wayne', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.0804', 'lon' => '-85.1392', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fort wayne', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'frederick' => array( 'name' => 'Frederick', 'city' => 'frederick', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.4140', 'lon' => '-77.4105', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'frederick', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fredericksburg' => array( 'name' => 'Fredericksburg', 'city' => 'fredericksburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.3032', 'lon' => '-77.4605', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fredericksburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'fresno / madera' => array( 'name' => 'Fresno / Madera', 'city' => 'Fresno', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.7500', 'lon' => '-119.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'fresno / madera', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ft myers / SW florida' => array( 'name' => 'Ft Myers / SW Florida', 'city' => 'ft myers / SW florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '26.6167', 'lon' => '-81.8333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ft myers / SW florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gadsden-anniston' => array( 'name' => 'Gadsden-Anniston', 'city' => 'gadsden-anniston', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.6598', 'lon' => '85.8316', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gadsden-anniston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gainesville' => array( 'name' => 'Gainesville', 'city' => 'gainesville', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.6520', 'lon' => '-82.3250', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gainesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'galveston' => array( 'name' => 'Galveston ', 'city' => 'galveston', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.2811', 'lon' => '-94.8258', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'galveston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'glens falls' => array( 'name' => 'Glens Falls', 'city' => 'glens falls', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.3095', 'lon' => '-73.6440', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'glens falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gold country' => array( 'name' => 'Gold Country', 'city' => 'gold country', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '38.6263', 'lon' => '-121.2466', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gold country', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand forks' => array( 'name' => 'Grand Forks', 'city' => 'grand forks', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.9253', 'lon' => '-97.0329', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand forks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand island' => array( 'name' => 'Grand Island', 'city' => 'grand island', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.9264', 'lon' => '-98.3420', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'grand rapids' => array( 'name' => 'Grand Rapids', 'city' => 'Grand Rapids', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.9612', 'lon' => '-85.6557', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'grand rapids', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'great falls' => array( 'name' => 'Great Falls', 'city' => 'great falls', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.5053', 'lon' => '-111.3008', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'great falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'green bay' => array( 'name' => 'Green Bay', 'city' => 'green bay', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.5133', 'lon' => '-88.0158', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'green bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'greensboro' => array( 'name' => 'Greensboro', 'city' => 'greensboro', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0800', 'lon' => '-79.8194', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'greensboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'greenville / upstate' => array( 'name' => 'Greenville / Upstate', 'city' => 'Greenville', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '34.8444', 'lon' => '-82.3856', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'greenville / upstate', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'gulfport / biloxi' => array( 'name' => 'Gulfport / Biloxi', 'city' => 'gulfport / biloxi', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.3674', 'lon' => '-89.0928', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'gulfport / biloxi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hampton roads' => array( 'name' => 'Hampton Roads', 'city' => 'Hampton Roads', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.9667', 'lon' => '-76.3667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hampton roads', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hanford-corcoran' => array( 'name' => 'Hanford-Corcoran', 'city' => 'hanford-corcoran', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.0988', 'lon' => '-119.8815', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hanford-corcoran', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'harrisburg' => array( 'name' => 'Harrisburg', 'city' => 'harrisburg', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.2697', 'lon' => '-76.8756', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'harrisburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'harrisonburg' => array( 'name' => 'Harrisonburg', 'city' => 'harrisonburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.4496', 'lon' => '-78.8689', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'harrisonburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hartford' => array( 'name' => 'Hartford', 'city' => 'Hartford', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.7627', 'lon' => '-72.6743', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hartford', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hattiesburg' => array( 'name' => 'Hattiesburg', 'city' => 'hattiesburg', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.3271', 'lon' => '-89.2903', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hattiesburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hawaii' => array( 'name' => 'Hawaii', 'city' => 'hawaii', 'state' => 'HI', 'state_expanded' => 'Hawaii', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '21.3114', 'lon' => '-157.7964', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hawaii', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'heartland florida' => array( 'name' => 'Heartland Florida', 'city' => 'heartland florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '27.2142', 'lon' => '-81.7787', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'heartland florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'helena' => array( 'name' => 'Helena', 'city' => 'helena', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.5891', 'lon' => '-112.0391', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'helena', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hickory / lenoir' => array( 'name' => 'Hickory / Lenoir', 'city' => 'hickory / lenoir', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.7345', 'lon' => '-81.3445', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hickory / lenoir', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'high rockies' => array( 'name' => 'High Rockies', 'city' => 'high rockies', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.2234', 'lon' => '-105.9955', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'high rockies', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'hilton head' => array( 'name' => 'Hilton Head Island', 'city' => 'hilton head', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.2163', 'lon' => '-80.7526', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hilton head', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'holland' => array( 'name' => 'Holland', 'city' => 'holland', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.7875', 'lon' => '-86.1089', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'holland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'Holyoke' => array( 'name' => 'Holyoke', 'city' => 'Holyoke', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '42.2042', 'lon' => '-72.6167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'Holyoke', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'houma' => array( 'name' => 'Houma', 'city' => 'houma', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.5958', 'lon' => '-90.7195', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'houma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'houston' => array( 'name' => 'Houston', 'city' => 'Houston', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '29.7602', 'lon' => '-95.3694', 'background-class' => 'houston-panel', 'background_class' => 'houston-panel', 'key_value' => 'houston', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'hudson valley' => array( 'name' => 'Hudson Valley', 'city' => 'Hudson Valley', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.1500', 'lon' => '-73.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'hudson valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'humboldt county' => array( 'name' => 'Humboldt County', 'city' => 'humboldt county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.7450', 'lon' => '-123.8690', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'humboldt county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'huntsville / decatur' => array( 'name' => 'Huntsville / Decatur', 'city' => 'huntsville / decatur', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.5810', 'lon' => '-86.9834', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'huntsville / decatur', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'imperial county' => array( 'name' => 'Imperial County', 'city' => 'imperial county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.0114', 'lon' => '-115.4734', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'imperial county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'indianapolis' => array( 'name' => 'Indianapolis', 'city' => 'Indianapolis', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.7910', 'lon' => '-86.1480', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'indianapolis', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'inland empire' => array( 'name' => 'Inland Empire', 'city' => 'Inland Empire', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '34.1216', 'lon' => '-116.9300', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'inland empire', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'iowa city' => array( 'name' => 'Iowa City', 'city' => 'iowa city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.6611', 'lon' => '-91.5302', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'iowa city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ithaca' => array( 'name' => 'Ithaca', 'city' => 'ithaca', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4440', 'lon' => '-76.5019', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ithaca', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jackson' => array( 'name' => 'Jackson', 'city' => 'jackson', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.6145', 'lon' => '-88.8139', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jackson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jacksonville' => array( 'name' => 'Jacksonville NC', 'city' => 'jacksonville', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.7541', 'lon' => '-77.4302', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jacksonville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'janesville' => array( 'name' => 'Janesville', 'city' => 'janesville', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.6839', 'lon' => '-89.0164', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'janesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jersey shore' => array( 'name' => 'Jersey Shore', 'city' => 'Jersey Shore', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.2025', 'lon' => '-77.2667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jersey shore', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'jonesboro' => array( 'name' => 'Jonesboro', 'city' => 'jonesboro', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.8423', 'lon' => '90.7043', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'jonesboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'joplin' => array( 'name' => 'Joplin', 'city' => 'joplin', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.0842', 'lon' => '-94.5133', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'joplin', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kalamazoo' => array( 'name' => 'Kalamazoo', 'city' => 'kalamazoo', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.2900', 'lon' => '-85.5858', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kalamazoo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kalispell' => array( 'name' => 'Kalispell', 'city' => 'kalispell', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '48.1920', 'lon' => '-114.3168', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kalispell', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kansas city' => array( 'name' => 'Kansas City MO', 'city' => 'kansas city', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.0997', 'lon' => '-94.5786', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kansas city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kenai peninsula' => array( 'name' => 'Kenai Peninsula Borough', 'city' => 'kenai peninsula', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '60.0858', 'lon' => '151.3823', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kenai peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kennewick-pasco-richland' => array( 'name' => 'Kennewick-Pasco-Richland', 'city' => 'kennewick-pasco-richland', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.2087', 'lon' => '-119.1199', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kennewick-pasco-richland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kenosha-racine' => array( 'name' => 'Kenosha-Racine', 'city' => 'kenosha-racine', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.5881', 'lon' => '-87.8229', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kenosha-racine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'killeen / temple / ft hood' => array( 'name' => 'Temple / Kileen / Ft Hood', 'city' => 'Temple', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '31.0936', 'lon' => '-97.3622', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'killeen / temple / ft hood', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'kirksville' => array( 'name' => 'Kirksville', 'city' => 'kirksville', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1948', 'lon' => '-92.5832', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kirksville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'klamath falls' => array( 'name' => 'Klamath Falls', 'city' => 'klamath falls', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.2249', 'lon' => '-121.7817', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'klamath falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'knoxville' => array( 'name' => 'Knoxville', 'city' => 'Knoxville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.9728', 'lon' => '-83.9422', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'knoxville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'kokomo' => array( 'name' => 'Kokomo', 'city' => 'kokomo', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4864', 'lon' => '-86.1336', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'kokomo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'la crosse' => array( 'name' => 'La Crosse', 'city' => 'la crosse', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '43.8138', 'lon' => '-91.2519', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'la crosse', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'la salle co' => array( 'name' => 'La Salle Co', 'city' => 'la salle co', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.3622', 'lon' => '-89.0418', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'la salle co', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lafayette' => array( 'name' => 'Lafayette', 'city' => 'lafayette', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.2241', 'lon' => '-92.0198', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lafayette', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lafayette / west lafayette' => array( 'name' => 'Lafayette / West Lafayette', 'city' => 'lafayette / west lafayette', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4259', 'lon' => '-86.9081', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lafayette / west lafayette', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lake charles' => array( 'name' => 'Lake Charles', 'city' => 'lake charles', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.2266', 'lon' => '-93.2174', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lake charles', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lake of the ozarks' => array( 'name' => 'Lake Of The Ozarks', 'city' => 'lake of the ozarks', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.1380', 'lon' => '-92.8104', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lake of the ozarks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lakeland' => array( 'name' => 'Lakeland', 'city' => 'lakeland', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '28.0411', 'lon' => '-81.9589', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lakeland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lancaster' => array( 'name' => 'Lancaster', 'city' => 'lancaster', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.0397', 'lon' => '-76.3044', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lancaster', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lansing' => array( 'name' => 'Lansing', 'city' => 'lansing', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.7336', 'lon' => '-84.5467', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lansing', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'laredo' => array( 'name' => 'Laredo', 'city' => 'laredo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '27.5036', 'lon' => '-99.5076', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'laredo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'las cruces' => array( 'name' => 'Las Cruces', 'city' => 'las cruces', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3199', 'lon' => '-106.7637', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'las cruces', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'las vegas' => array( 'name' => 'Las Vegas', 'city' => 'Las Vegas', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '36.1699', 'lon' => '-115.1398', 'background-class' => 'lasvegas-panel', 'background_class' => 'lasvegas-panel', 'key_value' => 'las vegas', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'lawrence' => array( 'name' => 'Lawrence', 'city' => 'lawrence', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.9717', 'lon' => '-95.2353', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lawrence', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lawton' => array( 'name' => 'Lawton', 'city' => 'lawton', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.6036', 'lon' => '-98.3959', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lawton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lehigh valley' => array( 'name' => 'Lehigh Valley', 'city' => 'lehigh valley', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.6017', 'lon' => '-75.4772', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lehigh valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lewiston / clarkston' => array( 'name' => 'Lewiston / Clarkston', 'city' => 'lewiston / clarkston', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.4004', 'lon' => '-117.0012', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lewiston / clarkston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lexington' => array( 'name' => 'Lexington', 'city' => 'lexington', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '38.0297', 'lon' => '-84.4947', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lexington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lima / findlay' => array( 'name' => 'Lima / Findlay', 'city' => 'lima / findlay', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.7426', 'lon' => '-84.1052', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lima / findlay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lincoln' => array( 'name' => 'Lincoln', 'city' => 'Lincoln', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.8106', 'lon' => '-96.6803', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lincoln', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'little rock' => array( 'name' => 'Little Rock', 'city' => 'little rock', 'state' => 'AR', 'state_expanded' => 'Arkansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.7361', 'lon' => '-92.3311', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'little rock', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'logan' => array( 'name' => 'Logan', 'city' => 'logan', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.7378', 'lon' => '-111.8308', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'logan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'long island' => array( 'name' => 'Long Island', 'city' => 'long island', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.7891', 'lon' => '-73.1350', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'long island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'los angeles' => array( 'name' => 'Los Angeles', 'city' => 'Los Angeles', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '34.0522', 'lon' => '-118.2437', 'background-class' => 'la-panel', 'background_class' => 'la-panel', 'key_value' => 'los angeles', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'louisville' => array( 'name' => 'Louisville', 'city' => 'Louisville', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.2500', 'lon' => '-85.7667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'louisville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lubbock' => array( 'name' => 'Lubbock', 'city' => 'lubbock', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '33.5667', 'lon' => '-101.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lubbock', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'lynchburg' => array( 'name' => 'Lynchburg', 'city' => 'lynchburg', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.4138', 'lon' => '-79.1422', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'lynchburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'macon / warner robins' => array( 'name' => 'Macon / Warner Robins', 'city' => 'macon / warner robins', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.8407', 'lon' => '-83.6324', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'macon / warner robins', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'madison' => array( 'name' => 'Madison', 'city' => 'Madison', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.0667', 'lon' => '-89.4000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'madison', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'maine' => array( 'name' => 'Maine', 'city' => 'Maine', 'state' => 'ME', 'state_expanded' => 'Maine', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '45.5000', 'lon' => '-69.0000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'maine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'manhattan' => array( 'name' => 'Manhattan', 'city' => 'manhattan', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.1836', 'lon' => '-96.5717', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'manhattan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mankato' => array( 'name' => 'Mankato', 'city' => 'mankato', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.1636', 'lon' => '-93.9994', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mankato', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mansfield' => array( 'name' => 'Mansfield', 'city' => 'mansfield', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.7584', 'lon' => '-82.5154', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mansfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mason city' => array( 'name' => 'Mason City', 'city' => 'mason city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '143.1536', 'lon' => '-93.2010', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mason city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mattoon-charleston' => array( 'name' => 'Mattoon-Charleston', 'city' => 'mattoon-charleston', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4961', 'lon' => '-88.1762', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mattoon-charleston', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mcallen / edinburg' => array( 'name' => 'McAllen / Edinburg', 'city' => 'mcallen / edinburg', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '26.2164', 'lon' => '-98.2364', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mcallen / edinburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'meadville' => array( 'name' => 'Meadville', 'city' => 'meadville', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.6414', 'lon' => '80.1514', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'meadville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'medford-ashland' => array( 'name' => 'Medford-Ashland', 'city' => 'medford-ashland', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.1946', 'lon' => '-122.7095', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'medford-ashland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'memphis' => array( 'name' => 'Memphis', 'city' => 'Memphis', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.1174', 'lon' => '-89.9711', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'memphis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mendocino county' => array( 'name' => 'Mendocino County', 'city' => 'mendocino county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.5500', 'lon' => '-123.4384', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mendocino county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'merced' => array( 'name' => 'Merced', 'city' => 'merced', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.3022', 'lon' => '-120.4830', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'merced', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'meridian' => array( 'name' => 'Meridian', 'city' => 'meridian', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3643', 'lon' => '-88.7037', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'meridian', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'miami' => array( 'name' => 'Miami', 'city' => 'Miami', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '25.7891', 'lon' => '-80.2040', 'background-class' => 'miami-panel', 'background_class' => 'miami-panel', 'key_value' => 'miami', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'milwaukee' => array( 'name' => 'Milwaukee', 'city' => 'Milwaukee', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '43.0500', 'lon' => '87.9500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'milwaukee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'minneapolis' => array( 'name' => 'Minneapolis / St. Paul', 'city' => 'minneapolis', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '44.9778', 'lon' => '-93.2650', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'minneapolis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'missoula' => array( 'name' => 'Missoula', 'city' => 'missoula', 'state' => 'MT', 'state_expanded' => 'Montana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.8721', 'lon' => '-113.9940', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'missoula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mobile' => array( 'name' => 'Mobile', 'city' => 'Mobile', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.6944', 'lon' => '88.0431', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mobile', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'modesto' => array( 'name' => 'Modesto', 'city' => 'modesto', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.6614', 'lon' => '-120.9944', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'modesto', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'mohave county' => array( 'name' => 'Mohave County', 'city' => 'mohave county', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.2143', 'lon' => '113.7633', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'mohave county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'monroe' => array( 'name' => 'Monroe MI', 'city' => 'monroe', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.9164', 'lon' => '-83.3977', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'monroe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'monterey bay' => array( 'name' => 'Monterey Bay', 'city' => 'monterey bay', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.8000', 'lon' => '-121.9000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'monterey bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'montgomery' => array( 'name' => 'Montgomery', 'city' => 'montgomery', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3792', 'lon' => '86.3077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'montgomery', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'morgantown' => array( 'name' => 'Morgantown', 'city' => 'morgantown', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.6336', 'lon' => '-79.9506', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'morgantown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'moses lake' => array( 'name' => 'Moses Lake', 'city' => 'moses lake', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.1301', 'lon' => '-119.2781', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'moses lake', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'muncie / anderson' => array( 'name' => 'Muncie / Anderson', 'city' => 'muncie / anderson', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.1934', 'lon' => '-85.3864', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'muncie / anderson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'muskegon' => array( 'name' => 'Muskegon', 'city' => 'muskegon', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2342', 'lon' => '-86.2484', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'muskegon', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'myrtle beach' => array( 'name' => 'Myrtle Beach', 'city' => 'myrtle beach', 'state' => 'SC', 'state_expanded' => 'South Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '33.7167', 'lon' => '-78.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'myrtle beach', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'nashville' => array( 'name' => 'Nashville', 'city' => 'nashville', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '36.1667', 'lon' => '-86.7833', 'background-class' => 'nashville-panel', 'background_class' => 'nashville-panel', 'key_value' => 'nashville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest MS' => array( 'name' => 'Natchez', 'city' => 'southwest MS', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5604', 'lon' => '-91.4032', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest MS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new hampshire' => array( 'name' => 'New Hampshire', 'city' => 'Waterville Valley', 'state' => 'NH', 'state_expanded' => 'New Hampshire', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '44.0000', 'lon' => '-71.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new hampshire', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'new haven' => array( 'name' => 'New Haven ', 'city' => 'New Haven ', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.3100', 'lon' => '-72.9236', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new haven', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new orleans' => array( 'name' => 'New Orleans', 'city' => 'New Orleans', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '29.9500', 'lon' => '-90.0667', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new orleans', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'new river valley' => array( 'name' => 'New River Valley', 'city' => 'new river valley', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.1384', 'lon' => '-80.6812', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'new river valley', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north central FL' => array( 'name' => 'North Central FL', 'city' => 'north central FL', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.5383', 'lon' => '-81.3792', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north central FL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north dakota' => array( 'name' => 'North Dakota', 'city' => 'north dakota', 'state' => 'ND', 'state_expanded' => 'North Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.5515', 'lon' => '-101.0020', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north dakota', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north jersey' => array( 'name' => 'North Jersey', 'city' => 'North Jersey', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '40.7915', 'lon' => '-74.2624', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north jersey', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north mississippi' => array( 'name' => 'North Mississippi', 'city' => 'north mississippi', 'state' => 'MS', 'state_expanded' => 'Mississippi', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.3547', 'lon' => '-89.3985', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north mississippi', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'north platte' => array( 'name' => 'North Platte', 'city' => 'north platte', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.1403', 'lon' => '-100.7601', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'north platte', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northeast SD' => array( 'name' => 'Northeast SD', 'city' => 'northeast SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.8711', 'lon' => '-97.3973', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northeast SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern michigan' => array( 'name' => 'Northern Michigan', 'city' => 'northern michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.5596', 'lon' => '-87.4045', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern panhandle' => array( 'name' => 'Northern Panhandle', 'city' => 'northern panhandle', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.0640', 'lon' => '-80.7209', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northern WI' => array( 'name' => 'Northern WI', 'city' => 'northern WI', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '45.8077', 'lon' => '-89.7251', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northern WI', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest CT' => array( 'name' => 'Northwest CT', 'city' => 'northwest CT', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8253', 'lon' => '-73.1016', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest CT', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest GA' => array( 'name' => 'Northwest GA', 'city' => 'northwest GA', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.1661', 'lon' => '-84.8006', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest GA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest KS' => array( 'name' => 'Northwest KS', 'city' => 'northwest KS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.3992', 'lon' => '-101.0464', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'northwest OK' => array( 'name' => 'Northwest OK', 'city' => 'northwest OK', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.9420', 'lon' => '-95.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'northwest OK', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ocala' => array( 'name' => 'Ocala', 'city' => 'ocala', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '29.1878', 'lon' => '-82.1306', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ocala', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'odessa' => array( 'name' => 'Odessa / Midland', 'city' => 'odessa / midland', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '31.8633', 'lon' => '-102.3656', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'odessa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ogden-clearfield' => array( 'name' => 'Ogden–Clearfield', 'city' => 'ogden-clearfield', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.1645', 'lon' => '-112.0476', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ogden-clearfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'okaloosa / walton' => array( 'name' => 'Okaloosa / Walton', 'city' => 'okaloosa / walton', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.4201', 'lon' => '-86.6170', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'okaloosa / walton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'oklahoma city' => array( 'name' => 'Oklahoma City', 'city' => 'Oklahoma City', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.4822', 'lon' => '-97.5350', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oklahoma city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'olympic peninsula' => array( 'name' => 'Olympic Peninsula', 'city' => 'olympic peninsula', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.8021', 'lon' => '-123.6044', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'olympic peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'omaha / council bluffs' => array( 'name' => 'Omaha / Council bluffs', 'city' => 'Omaha', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.2500', 'lon' => '-96.0000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'omaha / council bluffs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'oneonta' => array( 'name' => 'Oneonta', 'city' => 'oneonta', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4529', 'lon' => '-75.0638', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oneonta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'orange county' => array( 'name' => 'Orange County', 'city' => 'Irvine', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '33.7175', 'lon' => '-117.8311', 'background-class' => 'orangecounty-panel', 'background_class' => 'orangecounty-panel', 'key_value' => 'orange county', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'oregon coast' => array( 'name' => 'Oregon Coast', 'city' => 'oregon coast', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.1871', 'lon' => '-124.1146', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'oregon coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'orlando' => array( 'name' => 'Orlando', 'city' => 'orlando', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '28.4158', 'lon' => '-81.2989', 'background-class' => 'orlando-panel', 'background_class' => 'orlando-panel', 'key_value' => 'orlando', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast IA' => array( 'name' => 'Ottumwa', 'city' => 'southeast IA', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.0160', 'lon' => '-92.4083', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast IA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'outer banks' => array( 'name' => 'Outer Banks', 'city' => 'outer banks', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '35.5585', 'lon' => '-75.4665', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'outer banks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'owensboro' => array( 'name' => 'Owensboro', 'city' => 'owensboro', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.7719', 'lon' => '-87.1112', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'owensboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'palm springs' => array( 'name' => 'Palm Springs', 'city' => 'Palm Springs', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '33.8303', 'lon' => '-116.5453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'palm springs', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'panama city' => array( 'name' => 'Panama City', 'city' => 'panama city', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.1588', 'lon' => '-85.6602', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'panama city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'parkersburg-marietta' => array( 'name' => 'Parkersburg-Marietta', 'city' => 'parkersburg-marietta', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.2821', 'lon' => '-81.5377', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'parkersburg-marietta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pensacola' => array( 'name' => 'Pensacola', 'city' => 'pensacola', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '30.4333', 'lon' => '-87.2000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pensacola', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'peoria' => array( 'name' => 'Peoria', 'city' => 'peoria', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.6936', 'lon' => '-89.5890', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'peoria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'philadelphia' => array( 'name' => 'Philadelphia', 'city' => 'Philadelphia', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '39.9523', 'lon' => '-75.1638', 'background-class' => 'philadelphia-panel', 'background_class' => 'philadelphia-panel', 'key_value' => 'philadelphia', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'phoenix' => array( 'name' => 'Phoenix', 'city' => 'phoenix', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '33.4484', 'lon' => '-112.0740', 'background-class' => 'phoenix-panel', 'background_class' => 'phoenix-panel', 'key_value' => 'phoenix', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pierre / central SD' => array( 'name' => 'Pierre / Central SD', 'city' => 'pierre / central SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.3668', 'lon' => '-100.3538', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pierre / central SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pittsburgh' => array( 'name' => 'Pittsburgh', 'city' => 'Pittsburgh', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '40.4397', 'lon' => '-79.9764', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pittsburgh', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'plantsville' => array( 'name' => 'Plantsville', 'city' => 'Plantsville', 'state' => 'CT', 'state_expanded' => 'Connecticut', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '41.5906', 'lon' => '-72.8931', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'plantsville', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'plattsburgh-adirondacks' => array( 'name' => 'Plattsburgh-Adirondacks', 'city' => 'plattsburgh-adirondacks', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.6995', 'lon' => '-73.4529', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'plattsburgh-adirondacks', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'poconos' => array( 'name' => 'Poconos', 'city' => 'poconos', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.0700', 'lon' => '-75.4345', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'poconos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'port huron' => array( 'name' => 'Port Huron', 'city' => 'port huron', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.9709', 'lon' => '-82.4249', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'port huron', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'portland' => array( 'name' => 'Portland', 'city' => 'portland', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '45.5235', 'lon' => '-122.6762', 'background-class' => 'portland-panel', 'background_class' => 'portland-panel', 'key_value' => 'portland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'potsdam-canton-massena' => array( 'name' => 'Potsdam-Canton-Massena', 'city' => 'potsdam-canton-massena', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.9281', 'lon' => '-74.8919', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'potsdam-canton-massena', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'prescott' => array( 'name' => 'Prescott', 'city' => 'prescott', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.5400', 'lon' => '-112.4685', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'prescott', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'provo / orem' => array( 'name' => 'Provo / Orem', 'city' => 'provo / orem', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '0', 'cl_posting_fee' => '10', 'lat' => '40.2444', 'lon' => '-111.6608', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'provo / orem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pueblo' => array( 'name' => 'Pueblo', 'city' => 'pueblo', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.2544', 'lon' => '-104.6091', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pueblo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'pullman / moscow' => array( 'name' => 'Pullman / Moscow', 'city' => 'pullman / moscow', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.7324', 'lon' => '-117.0002', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'pullman / moscow', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'quad cities' => array( 'name' => 'Quad Cities', 'city' => 'quad cities', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.5236', 'lon' => '-90.5776', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'quad cities', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'raleigh / durham / CH' => array( 'name' => 'raleigh / durham / CH', 'city' => 'raleigh', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '35.7806', 'lon' => '-78.6389', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'raleigh / durham / CH', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rapid city / west SD' => array( 'name' => 'Rapid City / West SD', 'city' => 'rapid city / west SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.0805', 'lon' => '-103.2310', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rapid city / west SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'reading' => array( 'name' => 'Reading', 'city' => 'reading', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.3417', 'lon' => '-75.9264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'reading', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'redding' => array( 'name' => 'Redding', 'city' => 'redding', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '40.5865', 'lon' => '-122.3917', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'redding', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'reno / tahoe' => array( 'name' => 'Reno / Tahoe', 'city' => 'reno / tahoe', 'state' => 'NV', 'state_expanded' => 'Nevada', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.5272', 'lon' => '-119.8219', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'reno / tahoe', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rhode island' => array( 'name' => 'Rhode Island', 'city' => 'Rhode Island', 'state' => 'RI', 'state_expanded' => 'Rhode Island', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '41.7000', 'lon' => '-71.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rhode island', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'richmond' => array( 'name' => 'Richmond', 'city' => 'richmond', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.5407', 'lon' => '-77.4360', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'richmond', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roanoke' => array( 'name' => 'Roanoke', 'city' => 'roanoke', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '37.2710', 'lon' => '-79.9414', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roanoke', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rochester' => array( 'name' => 'Rochester MN', 'city' => 'rochester', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.0121', 'lon' => '-92.4802', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rochester', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'rockford' => array( 'name' => 'Rockford', 'city' => 'rockford', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '42.2594', 'lon' => '-89.0644', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'rockford', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roseburg' => array( 'name' => 'Roseburg', 'city' => 'roseburg', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2165', 'lon' => '-123.3417', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roseburg', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'roswell / carlsbad' => array( 'name' => 'Roswell / Carlsbad', 'city' => 'roswell / carlsbad', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.3943', 'lon' => '-104.5230', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'roswell / carlsbad', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sacramento' => array( 'name' => 'Sacramento', 'city' => 'Sacramento', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '38.5556', 'lon' => '-121.4689', 'background-class' => 'sacramento-panel', 'background_class' => 'sacramento-panel', 'key_value' => 'sacramento', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'saginaw-midland-baycity' => array( 'name' => 'Saginaw-Midland-Baycity', 'city' => 'saginaw-midland-baycity', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.5945', 'lon' => '-83.8889', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'saginaw-midland-baycity', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salem' => array( 'name' => 'Salem', 'city' => 'salem', 'state' => 'OR', 'state_expanded' => 'Oregon', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.9308', 'lon' => '-123.0289', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'salem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salina' => array( 'name' => 'Salina', 'city' => 'salina', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.8403', 'lon' => '-97.6114', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'salina', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'salt lake city' => array( 'name' => 'Salt Lake City', 'city' => 'salt lake city', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '40.7500', 'lon' => '-111.8833', 'background-class' => 'saltlakecity-panel', 'background_class' => 'saltlakecity-panel', 'key_value' => 'salt lake city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san angelo' => array( 'name' => 'San Angelo', 'city' => 'san angelo', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.4500', 'lon' => '-100.4500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san angelo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san antonio' => array( 'name' => 'San Antonio', 'city' => 'san antonio', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '29.4167', 'lon' => '-98.5000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san antonio', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san diego' => array( 'name' => 'San Diego', 'city' => 'San Diego', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '32.7157', 'lon' => '-117.1611', 'background-class' => 'sandiego-panel', 'background_class' => 'sandiego-panel', 'key_value' => 'san diego', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'san francisco bay area' => array( 'name' => 'San Francisco Bay Area', 'city' => 'San Francisco', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '75', 'lat' => '37.7771', 'lon' => '-122.4170', 'background-class' => 'sf-panel', 'background_class' => 'sf-panel', 'key_value' => 'san francisco bay area', 'pricing_plan_id' => '12', 'subscription_plan_id' => '8' ), 'san luis obispo' => array( 'name' => 'San Luis Obispo', 'city' => 'san luis obispo', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '35.2742', 'lon' => '120.6631', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san luis obispo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'san marcos' => array( 'name' => 'San Marcos', 'city' => 'san marcos', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '29.8833', 'lon' => '-29.8833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'san marcos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sandusky' => array( 'name' => 'Sandusky', 'city' => 'sandusky', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.4562', 'lon' => '-82.7117', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sandusky', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa barbara' => array( 'name' => 'Santa Barbara', 'city' => 'Santa Barbara', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '34.4258', 'lon' => '-119.7142', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa barbara', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa fe / taos' => array( 'name' => 'Santa Fe / Taos', 'city' => 'santa fe / taos', 'state' => 'NM', 'state_expanded' => 'New Mexico', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '35.6870', 'lon' => '-105.9378', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa fe / taos', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'santa maria' => array( 'name' => 'Santa Maria', 'city' => 'santa maria', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '0', 'cl_posting_fee' => '15', 'lat' => '34.9514', 'lon' => '-120.4333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'santa maria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sarasota-bradenton' => array( 'name' => 'Sarasota-Bradenton', 'city' => 'Sarasota', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '27.3372', 'lon' => '-82.5353', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sarasota-bradenton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'savannah / hinesville' => array( 'name' => 'Savannah / Hinesville', 'city' => 'savannah / hinesville', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '32.0167', 'lon' => '-81.1167', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'savannah / hinesville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'scottsbluff / panhandle' => array( 'name' => 'Scottsbluff / Panhandle', 'city' => 'scottsbluff / panhandle', 'state' => 'NE', 'state_expanded' => 'Nebraska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.8666', 'lon' => '-103.6672', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'scottsbluff / panhandle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'scranton / wilkes-barre' => array( 'name' => 'scranton / wilkes-barre', 'city' => 'scranton / wilkes-barre', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.4106', 'lon' => '-75.6675', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'scranton / wilkes-barre', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'seattle' => array( 'name' => 'Seattle-tacoma', 'city' => 'seattle', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '47.6062', 'lon' => '-122.3321', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'seattle', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sheboygan' => array( 'name' => 'Sheboygan', 'city' => 'sheboygan', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.7508', 'lon' => '-87.7145', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sheboygan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'show low' => array( 'name' => 'Show Low', 'city' => 'show low', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '34.2542', 'lon' => '-110.0298', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'show low', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'shreveport' => array( 'name' => 'Shreveport', 'city' => 'shreveport', 'state' => 'LA', 'state_expanded' => 'Louisiana', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.5252', 'lon' => '-93.7502', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'shreveport', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sierra vista' => array( 'name' => 'Sierra Vista', 'city' => 'sierra vista', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '31.5455', 'lon' => '-110.2773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sierra vista', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sioux city' => array( 'name' => 'Sioux City', 'city' => 'sioux city', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.4963', 'lon' => '-96.4049', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sioux city', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'sioux falls / SE SD' => array( 'name' => 'Sioux Falls / SE SD', 'city' => 'sioux falls / SE SD', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.5473', 'lon' => '-96.7283', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'sioux falls / SE SD', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'siskiyou county' => array( 'name' => 'Siskiyou County', 'city' => 'siskiyou county', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.7743', 'lon' => '-122.5770', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'siskiyou county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'skagit' => array( 'name' => 'Skagit', 'city' => 'Concrete', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '0', 'cl_posting_fee' => '0', 'lat' => '48.4800', 'lon' => '-121.7800', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'skagit', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'skagit / island / SJI' => array( 'name' => 'Skagit / Island / SJI', 'city' => 'skagit / island / SJI', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '48.4242', 'lon' => '-121.7114', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'skagit / island / SJI', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south bend / michiana' => array( 'name' => 'South Bend / Michiana', 'city' => 'south bend / michiana', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6725', 'lon' => '-86.2553', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south bend / michiana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south coast' => array( 'name' => 'South Coast', 'city' => 'south coast', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6806', 'lon' => '-70.9083', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south dakota' => array( 'name' => 'South Dakota', 'city' => 'south dakota', 'state' => 'SD', 'state_expanded' => 'South Dakota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.9695', 'lon' => '-99.9018', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south dakota', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south florida' => array( 'name' => 'South Florida', 'city' => 'south florida', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '45', 'lat' => '26.1333', 'lon' => '-80.1500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south florida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'south jersey' => array( 'name' => 'South Jersey', 'city' => 'South Jersey', 'state' => 'NJ', 'state_expanded' => 'New Jersey', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '39.3773', 'lon' => '-74.4511', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'south jersey', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast alaska' => array( 'name' => 'Southeast Alaska', 'city' => 'southeast alaska', 'state' => 'AK', 'state_expanded' => 'Alaska', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '58.3019', 'lon' => '134.4197', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast alaska', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast KS' => array( 'name' => 'Southeast KS', 'city' => 'southeast KS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.4109', 'lon' => '-94.7050', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southeast missouri' => array( 'name' => 'Southeast Missouri', 'city' => 'southeast missouri', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.3149', 'lon' => '-89.5280', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southeast missouri', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern illinois' => array( 'name' => 'Southern Illinois', 'city' => 'southern illinois', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.6557', 'lon' => '-88.9988', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern illinois', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern maryland' => array( 'name' => 'Southern Maryland', 'city' => 'southern maryland', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.4154', 'lon' => '-76.7041', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern maryland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southern WV' => array( 'name' => 'Southern WV', 'city' => 'southern WV', 'state' => 'WV', 'state_expanded' => 'West Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.6743', 'lon' => '-82.2774', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southern WV', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest KS' => array( 'name' => 'Southwest KS', 'city' => 'southwest MS', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0431', 'lon' => '-100.9210', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest KS', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest michigan' => array( 'name' => 'Southwest Michigan', 'city' => 'southwest michigan', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.1274', 'lon' => '-86.4257', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest michigan', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest MN' => array( 'name' => 'Southwest MN', 'city' => 'southwest MN', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '44.9242', 'lon' => '-93.3087', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest MN', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest TX' => array( 'name' => 'Southwest TX', 'city' => 'southwest TX', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '29.1275', 'lon' => '-103.2425', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest TX', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'southwest VA' => array( 'name' => 'Southwest VA', 'city' => 'southwest VA', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.7098', 'lon' => '-81.9773', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'southwest VA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'space coast' => array( 'name' => 'Space Coast', 'city' => 'space coast', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '28.1167', 'lon' => '-80.6333', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'space coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'spokane / coeur d'alene' => array( 'name' => 'Spokane / Coeur d'alene', 'city' => 'Spokane', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '47.6589', 'lon' => '-117.4250', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'spokane / coeur d'alene', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'springfield' => array( 'name' => 'Springfield', 'city' => 'springfield', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.7817', 'lon' => '-89.6501', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'springfield', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st augustine' => array( 'name' => 'St Augustine', 'city' => 'st augustine', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '29.9012', 'lon' => '-81.3124', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st augustine', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st cloud' => array( 'name' => 'St Cloud', 'city' => 'st cloud', 'state' => 'MN', 'state_expanded' => 'Minnesota', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '45.5579', 'lon' => '-94.1632', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st cloud', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st george' => array( 'name' => 'St George', 'city' => 'st george', 'state' => 'UT', 'state_expanded' => 'Utah', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0965', 'lon' => '-113.5684', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st george', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st joseph' => array( 'name' => 'St Joseph', 'city' => 'st joseph', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.7675', 'lon' => '-94.8467', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st joseph', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'st louis' => array( 'name' => 'St. Louis', 'city' => 'st louis', 'state' => 'MO', 'state_expanded' => 'Missouri', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '38.6272', 'lon' => '-90.1978', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'st louis', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'state college' => array( 'name' => 'State College', 'city' => 'state college', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.7934', 'lon' => '-77.8600', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'state college', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'statesboro' => array( 'name' => 'Statesboro', 'city' => 'statesboro', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.4488', 'lon' => '-81.7832', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'statesboro', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'stillwater' => array( 'name' => 'Stillwater', 'city' => 'stillwater', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.1156', 'lon' => '-97.0584', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'stillwater', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'stockton' => array( 'name' => 'Stockton', 'city' => 'stockton', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.9756', 'lon' => '121.3008', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'stockton', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'susanville' => array( 'name' => 'Susanville', 'city' => 'susanville', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4163', 'lon' => '-120.6530', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'susanville', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'syracuse' => array( 'name' => 'Syracuse', 'city' => 'syracuse', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '43.0469', 'lon' => '-76.1444', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'syracuse', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tallahassee' => array( 'name' => 'Tallahassee', 'city' => 'Tallahassee', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '30.4550', 'lon' => '-84.2533', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tallahassee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tampa bay' => array( 'name' => 'Tampa Bay Area', 'city' => 'tampa bay', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '25.7891', 'lon' => '-80.2040', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tampa bay', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'terre haute' => array( 'name' => 'Terre Haute', 'city' => 'terre haute', 'state' => 'IN', 'state_expanded' => 'Indiana', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.4667', 'lon' => '-87.4139', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'terre haute', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'texarkana' => array( 'name' => 'Texarkana', 'city' => 'texarkana', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.4251', 'lon' => '-94.0477', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'texarkana', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'texoma' => array( 'name' => 'Texoma', 'city' => 'texoma', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.6357', 'lon' => '-96.6089', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'texoma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'the thumb' => array( 'name' => 'The Thumb', 'city' => 'the thumb', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.9709', 'lon' => '-82.4249', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'the thumb', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'toledo' => array( 'name' => 'Toledo', 'city' => 'toledo', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '41.6656', 'lon' => '-83.5753', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'toledo', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'topeka' => array( 'name' => 'Topeka', 'city' => 'topeka', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.0473', 'lon' => '-95.6752', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'topeka', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'treasure coast' => array( 'name' => 'Treasure Coast', 'city' => 'treasure coast', 'state' => 'FL', 'state_expanded' => 'Florida', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '27.6500', 'lon' => '-80.3833', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'treasure coast', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tri-cities' => array( 'name' => 'Tri-cities', 'city' => 'tri-cities', 'state' => 'TN', 'state_expanded' => 'Tennessee', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '36.5484', 'lon' => '-82.5618', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tri-cities', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tucson' => array( 'name' => 'Tucson', 'city' => 'Tucson', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '32.2217', 'lon' => '-110.9264', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tucson', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tulsa' => array( 'name' => 'Tulsa', 'city' => 'Tulsa', 'state' => 'OK', 'state_expanded' => 'Oklahoma', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '36.1314', 'lon' => '95.9372', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tulsa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tuscaloosa' => array( 'name' => 'Tuscaloosa', 'city' => 'tuscaloosa', 'state' => 'AL', 'state_expanded' => 'Alabama', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.2098', 'lon' => '87.5692', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tuscaloosa', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tuscarawas co' => array( 'name' => 'Tuscarawas Co', 'city' => 'tuscarawas co', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.3979', 'lon' => '-81.4279', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tuscarawas co', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'twin falls' => array( 'name' => 'Twin Falls', 'city' => 'twin falls', 'state' => 'ID', 'state_expanded' => 'Idaho', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.5558', 'lon' => '-114.4701', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'twin falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'twin tiers NY/PA' => array( 'name' => 'Twin Tiers NY/PA', 'city' => 'twin tiers NY/PA', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.0898', 'lon' => '-76.8077', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'twin tiers NY/PA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'tyler / east TX' => array( 'name' => 'Tyler / East TX', 'city' => 'Tyler', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '32.3500', 'lon' => '95.3000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'tyler / east TX', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'upper peninsula' => array( 'name' => 'Upper Peninsula', 'city' => 'upper peninsula', 'state' => 'MI', 'state_expanded' => 'Michigan', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '46.5375', 'lon' => '-87.3952', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'upper peninsula', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'utica-rome-oneida' => array( 'name' => 'Utica-Rome-Oneida', 'city' => 'utica-rome-oneida', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.2372', 'lon' => '-75.4345', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'utica-rome-oneida', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'valdosta' => array( 'name' => 'Valdosta', 'city' => 'valdosta', 'state' => 'GA', 'state_expanded' => 'Georgia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '30.8327', 'lon' => '-83.2785', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'valdosta', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'ventura county' => array( 'name' => 'Ventura County', 'city' => 'Ventura County', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '34.3600', 'lon' => '-119.1500', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'ventura county', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'vermont' => array( 'name' => 'Vermont', 'city' => 'vermont', 'state' => 'VT', 'state_expanded' => 'Vermont', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '44.2035', 'lon' => '-72.5623', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'vermont', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'victoria' => array( 'name' => 'Victoria', 'city' => 'victoria', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '28.8053', 'lon' => '-97.0036', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'victoria', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'visalia-tulare' => array( 'name' => 'Visalia-tulare', 'city' => 'visalia-tulare', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '36.3302', 'lon' => '-119.2921', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'visalia-tulare', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'waco' => array( 'name' => 'Waco', 'city' => 'waco', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '31.5514', 'lon' => '-97.1558', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'waco', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'washington' => array( 'name' => 'Washington', 'city' => 'Washington', 'state' => 'DC', 'state_expanded' => 'District of Columbia', 'paid_area' => '1', 'cl_posting_fee' => '35', 'lat' => '38.9072', 'lon' => '-77.0369', 'background-class' => 'washingtondc-panel', 'background_class' => 'washingtondc-panel', 'key_value' => 'washington', 'pricing_plan_id' => '12', 'subscription_plan_id' => '9' ), 'waterloo / cedar falls' => array( 'name' => 'Waterloo / Cedar Falls', 'city' => 'waterloo / cedar falls', 'state' => 'IA', 'state_expanded' => 'Iowa', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '42.5349', 'lon' => '-92.4453', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'waterloo / cedar falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'watertown' => array( 'name' => 'Watertown', 'city' => 'watertown', 'state' => 'NY', 'state_expanded' => 'New York', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.9748', 'lon' => '-75.9108', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'watertown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wausau' => array( 'name' => 'Wausau', 'city' => 'wausau', 'state' => 'WI', 'state_expanded' => 'Wisconsin', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '44.9591', 'lon' => '-89.6301', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wausau', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wenatchee' => array( 'name' => 'Wenatchee', 'city' => 'wenatchee', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '47.4235', 'lon' => '-120.3103', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wenatchee', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'west virginia (old)' => array( 'name' => 'West Virginia (old)', 'city' => 'west virginia (old)', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.3498', 'lon' => '-81.6326', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'west virginia (old)', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western IL' => array( 'name' => 'Western IL', 'city' => 'western IL', 'state' => 'IL', 'state_expanded' => 'Illinois', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.4727', 'lon' => '-90.6854', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western IL', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western KY' => array( 'name' => 'Western KY', 'city' => 'western KY', 'state' => 'KY', 'state_expanded' => 'Kentucky', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '37.0834', 'lon' => '-88.6000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western KY', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western maryland' => array( 'name' => 'Western Maryland', 'city' => 'western maryland', 'state' => 'MD', 'state_expanded' => 'Maryland', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.6255', 'lon' => '-78.6115', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western maryland', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western massachusetts' => array( 'name' => 'Western Massachusetts', 'city' => 'Springfield', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '42.4617', 'lon' => '-72.8944', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western massachusetts', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'western slope' => array( 'name' => 'Western Slope', 'city' => 'western slope', 'state' => 'CO', 'state_expanded' => 'Colorado', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '38.5754', 'lon' => '-107.7416', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'western slope', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wichita' => array( 'name' => 'Wichita', 'city' => 'wichita', 'state' => 'KS', 'state_expanded' => 'Kansas', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '37.6889', 'lon' => '-97.3361', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wichita', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wichita falls' => array( 'name' => 'Wichita Falls', 'city' => 'wichita falls', 'state' => 'TX', 'state_expanded' => 'Texas', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '33.9308', 'lon' => '-98.4849', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wichita falls', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'williamsport' => array( 'name' => 'Williamsport', 'city' => 'williamsport', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '41.2412', 'lon' => '-77.0011', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'williamsport', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wilmington' => array( 'name' => 'Wilmington', 'city' => 'wilmington', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '34.2233', 'lon' => '-77.9122', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wilmington', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'winchester' => array( 'name' => 'Winchester', 'city' => 'winchester', 'state' => 'VA', 'state_expanded' => 'Virginia', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.1857', 'lon' => '78.1633', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'winchester', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'winston-salem' => array( 'name' => 'Winston-salem', 'city' => 'winston-salem', 'state' => 'NC', 'state_expanded' => 'North Carolina', 'paid_area' => '1', 'cl_posting_fee' => '20', 'lat' => '36.0999', 'lon' => '-80.2442', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'winston-salem', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'worcester / central MA' => array( 'name' => 'Worcester / Central MA', 'city' => 'Worcester', 'state' => 'MA', 'state_expanded' => 'Massachusetts', 'paid_area' => '1', 'cl_posting_fee' => '25', 'lat' => '42.2667', 'lon' => '-71.8000', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'worcester / central MA', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'wyoming' => array( 'name' => 'Wyoming', 'city' => 'wyoming', 'state' => 'WY', 'state_expanded' => 'Wyoming', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '43.0760', 'lon' => '-107.2903', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'wyoming', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yakima' => array( 'name' => 'Yakima', 'city' => 'yakima', 'state' => 'WA', 'state_expanded' => 'Washington', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '46.6021', 'lon' => '-120.5059', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yakima', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'york' => array( 'name' => 'York', 'city' => 'york', 'state' => 'PA', 'state_expanded' => 'Pennsylvania', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '39.9669', 'lon' => '-76.7659', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'york', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'youngstown' => array( 'name' => 'Youngstown', 'city' => 'youngstown', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '15', 'lat' => '41.0998', 'lon' => '-80.6495', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'youngstown', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yuba-sutter' => array( 'name' => 'Yuba-sutter', 'city' => 'yuba-sutter', 'state' => 'CA', 'state_expanded' => 'California', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '39.1404', 'lon' => '-121.6169', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yuba-sutter', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'yuma' => array( 'name' => 'Yuma', 'city' => 'yuma', 'state' => 'AZ', 'state_expanded' => 'Arizona', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '32.6927', 'lon' => '-114.6277', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'yuma', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ), 'zanesville / cambridge' => array( 'name' => 'Zanesville / Cambridge', 'city' => 'zanesville / cambridge', 'state' => 'OH', 'state_expanded' => 'Ohio', 'paid_area' => '1', 'cl_posting_fee' => '10', 'lat' => '40.0312', 'lon' => '-81.5885', 'background-class' => 'generic-panel', 'background_class' => 'generic-panel', 'key_value' => 'zanesville / cambridge', 'pricing_plan_id' => '11', 'subscription_plan_id' => '9' ) ) $metatag_description = 'Jobs in Tulsa, Oklahoma.' $title_for_layout = 'Jobs in Tulsa, Oklahoma.' $no_index = true $isMobile = false $isWorker = false $isSales = false $isEducator = false $adminLoggedIn = false $isEmployer = false $loggedIn = false $isFacebookAppUser = false $campaign = 'NONE' $content_for_layout = ' <div id="loadingScreen"></div> <script type="text/javascript"> var sortOrder = "relevance"; </script> <div id="proven-job-search"> <div class="container search voffset4"> <div class="row"> <div class="col-xs-12 col-md-9"> <div class="row search-row"> <div class="col-sm-5 col-xs-6 search-field"> <input type="text" name="data[Search][search_text]" value="" id="search_text" placeholder="Job Title, Keywords, or Company" /> </div> <div class="col-sm-5 col-xs-6 search-field"> <input type="text" value="tulsa" id="search-location" placeholder="City, State or Zip" /> </div> <div class="col-sm-2 col-xs-12 search-field" style="height:50px;"> <a href="#" id="search-btn" class="light-green-btn" role="button" style="width:100%;">SEARCH</a> </div> </div> </div> </div> </div> <div class="container voffset2"> <div class="row"> <div class="col-xs-12 col-sm-12 col-md-9"> <div class="row sort-items"> <div class="col-sm-6 col-xs-6" style="padding-left: 0px;"> <h1>Search Jobs in Northwest OK</h1> </div> <div class="col-sm-6 col-xs-6 text-right" style="padding-right: 0px;"> <a class="sort-link sort-order-link active" sort_order="relevance" href="#" title="Relevance">Relevance</a> | <a href="#" class="sort-link sort-order-link " sort_order="date" title="Date">Date</a> </div> </div> <div class="row container-border"> <div class="col-sm-12"> <script type="text/javascript"> $(document).ready(function() { $(".row.list-item").bind("mouseenter",function(){ $(this).css("cursor", "pointer"); }).bind("mouseleave",function(){ $(this).css("cursor", "default"); }).bind("click",function(e){ var target = $(e.target); if(!target.parent().hasClass("job-link")) { window.location.href = $(this).find(".job-link").attr("href"); } }); $(".j2-link").click(function(e) { e.preventDefault(); }); $(".sh-job").click(function(e) { e.preventDefault(); var query = $(this).html();//"company:(" + $(this).html() + ")"; $("#search_text").val(query); $("#search-btn").click(); }); }); </script> <div id="search-results"> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="label">FEATURED</div> <div class="cl"> </div> </div> <h2> <a onMouseDown="xml_sclk(this);" class="job-link blue-link" title="View Uber Driver Partner - Earn Extra Income" target="_blank" href="/jobs/viewJob/123"><strong>Uber Driver Partner - Earn Extra Income</strong></a> </h2> <p class="details"> Uber - Austin - 22 hours ago </p> <p class="description">$18.10 an hour - Part-time Drive with Uber and help your community get around town. Driving with Uber is a great way to earn extra money when you need it. It’s flexible and works with your schedule. And now, when you register for Instant Pay, you can get paid to your debit card up to 5x daily....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Uber Driver Partner - Earn Extra Income" target="_blank" href="/jobs/viewJob/123"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Sub Arc" href="https://www.jobs2careers.com/click.php?jid=6fe781b1478c73ec2a5117bb1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A1mLRBGZyR2ujpkP4%253Amom2HpTWl6lzmkJHLqTLoQ%253D%253D%253AQ5qV5jgTE9yewyF%252FjpbjpepZ57sVMWLpsq2ZNtfOxTB%252BeSgrFJEWPifw9DUpBRYa9AbQDizMeTYoNgYm%252Bb%252BqY3Dbwc6gAY30TCwc6dQYi5vhzRNb5oajwguGz7XbC5aJVEz4ws4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074101/" target="_blank"><strong>Sub Arc</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Weekend Sub Arc Welder Pay: $19+/hr. Hours: Friday-Sunday 5AM-5:30PM or 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Must be Able to position header at machine clamping using an overhead or jib crane; turn cranks or pushes buttons to...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Sub Arc" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1478c73ec2a5117bb1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A1mLRBGZyR2ujpkP4%253Amom2HpTWl6lzmkJHLqTLoQ%253D%253D%253AQ5qV5jgTE9yewyF%252FjpbjpepZ57sVMWLpsq2ZNtfOxTB%252BeSgrFJEWPifw9DUpBRYa9AbQDizMeTYoNgYm%252Bb%252BqY3Dbwc6gAY30TCwc6dQYi5vhzRNb5oajwguGz7XbC5aJVEz4ws4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074101/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Facilities Tech B" href="https://www.jobs2careers.com/click.php?jid=7162da8f173c73edc204a45e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A920t3wBzForp%252B7dM%253AO66Ih0yomSFKUJpTpCIEzw%253D%253D%253AG114Ux%252FYvpEhNgSaxbmAbtiZpmw%252FdSMvPVl4JLCtukcASS2Wq0yiC2b1FwFnPQ1QOHbBtYJB4y%252Fkdyyreb3iuzc4ND6i7DAK4Pm5VY1G0O4j%252FxWhhTAI2KWh7Y7htR7QcjTnku4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848402/" target="_blank"><strong>Facilities Tech B</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Facilities Tech B Pay: $18+/hr. Hours: Day Shift Job type: Temp (4-6 Months) Location: Catoosa, Oklahoma Job Description: This position involves comprehensive reporting and adept navigation of the maintenance CMMS system. Duties include conducting preventive maintenance and repairs on...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Facilities Tech B" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8f173c73edc204a45e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A920t3wBzForp%252B7dM%253AO66Ih0yomSFKUJpTpCIEzw%253D%253D%253AG114Ux%252FYvpEhNgSaxbmAbtiZpmw%252FdSMvPVl4JLCtukcASS2Wq0yiC2b1FwFnPQ1QOHbBtYJB4y%252Fkdyyreb3iuzc4ND6i7DAK4Pm5VY1G0O4j%252FxWhhTAI2KWh7Y7htR7QcjTnku4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848402/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Service Tech - $46 - 65" href="https://www.jobs2careers.com/click.php?jid=6ff6ecc1fa5c73ec2b47c0b01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ACOtYemEEBpoJj3sB%253Au7wj8XKzz%252BnDI%252BoVCReC2g%253D%253D%253AlryBxkLsxxdR5wIVkt87pgWkS5eQ%252BZVaA1vx5MngI1e%252BNPuHkyj8oOycKp5w2Tnzwmzrz%252FAaIvuUZg2JVepVx%252BbW0xCCg0nloZCMOOrhG03HCsrtkqsjR9YSGgAH4fF%252BOCYmM9o%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053241280/" target="_blank"><strong>Service Tech - $46 - 65</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Service Tech - $46 - 65" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ecc1fa5c73ec2b47c0b01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ACOtYemEEBpoJj3sB%253Au7wj8XKzz%252BnDI%252BoVCReC2g%253D%253D%253AlryBxkLsxxdR5wIVkt87pgWkS5eQ%252BZVaA1vx5MngI1e%252BNPuHkyj8oOycKp5w2Tnzwmzrz%252FAaIvuUZg2JVepVx%252BbW0xCCg0nloZCMOOrhG03HCsrtkqsjR9YSGgAH4fF%252BOCYmM9o%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053241280/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Repair Technician Lead" href="https://www.jobs2careers.com/click.php?jid=6fe781b3308c73ec2a51179c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AQ%252F1OJ2AEBCHyxAk0%253AxYSAQY2cTfF3Q%252BpxtJOWFA%253D%253D%253Ae6sQOraYSvQKqUPpzN3VsNJc2hT2aR1jUM6IgRCmAVbKPEmHbYSEQjoCq%252FCnaivZAHxVuvJHn4psd7bVI%252B0BhohtEVMREdlNb42RZHCZrZUjs2ncd9EM59nFTzFiAJPFFtUXA20TZE8frgbmP6Wi&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074132/" target="_blank"><strong>Repair Technician Lead</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Repair Technician Lead Pay: $25-28/hr. Hours: Monday- Friday, Possible Weekends Job Type: Temp to Hire Location: Tulsa, Oklahoma Benefits: 401(k) matching, employee assistance program, life insurance Job Description: Seeking a proactive Repair Technician Lead experienced in commercial roofing...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Repair Technician Lead" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b3308c73ec2a51179c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AQ%252F1OJ2AEBCHyxAk0%253AxYSAQY2cTfF3Q%252BpxtJOWFA%253D%253D%253Ae6sQOraYSvQKqUPpzN3VsNJc2hT2aR1jUM6IgRCmAVbKPEmHbYSEQjoCq%252FCnaivZAHxVuvJHn4psd7bVI%252B0BhohtEVMREdlNb42RZHCZrZUjs2ncd9EM59nFTzFiAJPFFtUXA20TZE8frgbmP6Wi&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074132/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Welder - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=6ffdce73167c73ec2bf5eb9e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AA7D8Cx4KNDSQ9xsx%253Ac%252F1530g9SRi61rGfYAvVZA%253D%253D%253A9oNoMUPj8jd6f95m1rwujltjSzUQvEgWnnTJErtiXQqHBOggz9J9l1V3r%252BFR5bsI20xJVSIMU4%252FVgBzjSuPLgphonl2EuQy%252FSUN78aF27XemPcDKl1dMI3adVDdav8CcnMpmeTZoMhK3ARSUj2A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30060457170/" target="_blank"><strong>Welder - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Welder - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ffdce73167c73ec2bf5eb9e1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AA7D8Cx4KNDSQ9xsx%253Ac%252F1530g9SRi61rGfYAvVZA%253D%253D%253A9oNoMUPj8jd6f95m1rwujltjSzUQvEgWnnTJErtiXQqHBOggz9J9l1V3r%252BFR5bsI20xJVSIMU4%252FVgBzjSuPLgphonl2EuQy%252FSUN78aF27XemPcDKl1dMI3adVDdav8CcnMpmeTZoMhK3ARSUj2A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30060457170/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Service Tech" href="https://www.jobs2careers.com/click.php?jid=6fe781aefc8c73ec2a5116401&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AnoZ8MPScJivLhaSq%253AZko2V6ofKOHOHG77Og2BRg%253D%253D%253AQuzZxCftDpFJ7UAtN3sEQH%252FtYOvW7q5NxbWlHw37vW77A3xvM4u2Mwt6RDJo8Nv3nBTGZ1vGVN8iUGtcZG2Rpl2fz7O5Cp6%252FEmswr7KJwFXCUfYwGycyx2Rzas4ont0rZeSKG5M%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074064/" target="_blank"><strong>Service Tech</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Service Tech" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781aefc8c73ec2a5116401&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AnoZ8MPScJivLhaSq%253AZko2V6ofKOHOHG77Og2BRg%253D%253D%253AQuzZxCftDpFJ7UAtN3sEQH%252FtYOvW7q5NxbWlHw37vW77A3xvM4u2Mwt6RDJo8Nv3nBTGZ1vGVN8iUGtcZG2Rpl2fz7O5Cp6%252FEmswr7KJwFXCUfYwGycyx2Rzas4ont0rZeSKG5M%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074064/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb86272c73ec2b47b4cd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ABEorFyc0%252FBocuxT9%253A0auyhslrWVZ6MDikoO8OHg%253D%253D%253AhZETok%252BdrScztXTmE3Wd0lRn1UHjkMIQwX6uq8k6fPLF%252FbBs%252FaBvmY3IpQh1vIv1XJmnK%252FuLnb6cxEEvc%252BASU5x0w5WfGl3PP2rrZBpvtDGQOqlKa8YQ6vkZ5ZYPRxLUcFrTZifVdece2CoUyhE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236227/" target="_blank"><strong>Structural Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb86272c73ec2b47b4cd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ABEorFyc0%252FBocuxT9%253A0auyhslrWVZ6MDikoO8OHg%253D%253D%253AhZETok%252BdrScztXTmE3Wd0lRn1UHjkMIQwX6uq8k6fPLF%252FbBs%252FaBvmY3IpQh1vIv1XJmnK%252FuLnb6cxEEvc%252BASU5x0w5WfGl3PP2rrZBpvtDGQOqlKa8YQ6vkZ5ZYPRxLUcFrTZifVdece2CoUyhE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236227/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=7162da8e423c73edc204a44b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AfMlxJ9X34279DWZc%253Abo3giQ2w1jTIDbsuMsXOgg%253D%253D%253ASyY3RvhppgAT15Ys7swfpmf4JXiSuMVN4bo9w3AHBkuue27Mow91bzu%252F4gvwxiWE6Gf26FECzj2WyGnhd9%252F%252FILeyHv7HH6hC%252FcVfU6AG7vzwhTQy5Enzq1AxQF%252Br%252FLHbxX8INXieufk6Gadcy3I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848389/" target="_blank"><strong>Structural Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8e423c73edc204a44b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AfMlxJ9X34279DWZc%253Abo3giQ2w1jTIDbsuMsXOgg%253D%253D%253ASyY3RvhppgAT15Ys7swfpmf4JXiSuMVN4bo9w3AHBkuue27Mow91bzu%252F4gvwxiWE6Gf26FECzj2WyGnhd9%252F%252FILeyHv7HH6hC%252FcVfU6AG7vzwhTQy5Enzq1AxQF%252Br%252FLHbxX8INXieufk6Gadcy3I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848389/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Assembler" href="https://www.jobs2careers.com/click.php?jid=7037a4fe23dc73edd753434d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ARpsqUD39yA37TAwF%253A2qu%252FxqP%252BjPo8%252F3f%252B%252B8%252BY6w%253D%253D%253A6HPEIcKEM%252FQhy%252F2%252BUV1sboH0Nt6z8ZSUoCz7VVI273hqCl6o7thv9Uqw7aZR71CIasaPlBSJ6D4Fse9R4AjyUXXmkJebAWZdKSlSujLvgorhO2Z6XktZ4Y%252Bjsc%252B3daq%252Bgn5esg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30121104771/" target="_blank"><strong>Structural Assembler</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">This job was posted by : For more information, please see: Assembler {#aspanstylecolorblackstructuralassemblerspana}Pay: \$16-24hr. {#spanstylecolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylecolorblackd1624hrspan}Hours: Monday-Friday Day Shift {#spanstylecolorblackhoursspanspanstylecolorblackmondayfriday...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Assembler" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7037a4fe23dc73edd753434d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ARpsqUD39yA37TAwF%253A2qu%252FxqP%252BjPo8%252F3f%252B%252B8%252BY6w%253D%253D%253A6HPEIcKEM%252FQhy%252F2%252BUV1sboH0Nt6z8ZSUoCz7VVI273hqCl6o7thv9Uqw7aZR71CIasaPlBSJ6D4Fse9R4AjyUXXmkJebAWZdKSlSujLvgorhO2Z6XktZ4Y%252Bjsc%252B3daq%252Bgn5esg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30121104771/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View 6G Fitter Welder (Spools) - $27 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5ff25cc73edc0c5535d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AFtsFkP6vEfc1s3Vx%253AMzJxZaXlzbjCTBlYBi%252FGHw%253D%253D%253AXTW6Jv1EtbVUBbJ3QF%252F0DfGY9e%252FGDU3zsTbUHY8%252F2SuYzv4LRseCDMnMkK%252BqARiA0kQ%252Ft1G24sKSpnqiNBXn%252FwIHy%252FpegY%252FBq%252FC9y8UyKtUWxtkbaoq7IDZ19lrlyrb0HEmoaS57vHGxBtQbSP0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792659/" target="_blank"><strong>6G Fitter Welder (Spools) - $27 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">6G Fitter Welder (Spools) Pay: $27-28/hr. Hours: Monday-Friday 6AM-4:30PM (Saturday as needed) Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 6G Weld test Job Description: The role of the 6G Fitter Welder on Spools is pivotal in the fabrication and assembly of piping systems,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View 6G Fitter Welder (Spools) - $27 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5ff25cc73edc0c5535d1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AFtsFkP6vEfc1s3Vx%253AMzJxZaXlzbjCTBlYBi%252FGHw%253D%253D%253AXTW6Jv1EtbVUBbJ3QF%252F0DfGY9e%252FGDU3zsTbUHY8%252F2SuYzv4LRseCDMnMkK%252BqARiA0kQ%252Ft1G24sKSpnqiNBXn%252FwIHy%252FpegY%252FBq%252FC9y8UyKtUWxtkbaoq7IDZ19lrlyrb0HEmoaS57vHGxBtQbSP0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792659/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $23 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5fd70cc73edc0c553781&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8lsRZESezHZ%252BC5E4%253AefIdO7i3tA5wSzhS%252B%252FLdZA%253D%253D%253AruICfiIE8h7N3bihsgyky4WbzTa3HJaQkhDDjxvFmMD%252FnGxPDGWSK7HGUVPVERXNKQAPWEoJdywy0m3iYAH85OYPmMlOU1AQO%252BpCKn5e8hbjeEKCOv5aKK2fDQFnmcobRUBY4uMSqFBWawpPRM8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792632/" target="_blank"><strong>Structural Welder - $23 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Welder Pay: $23-25/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join our team. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $23 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fd70cc73edc0c553781&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8lsRZESezHZ%252BC5E4%253AefIdO7i3tA5wSzhS%252B%252FLdZA%253D%253D%253AruICfiIE8h7N3bihsgyky4WbzTa3HJaQkhDDjxvFmMD%252FnGxPDGWSK7HGUVPVERXNKQAPWEoJdywy0m3iYAH85OYPmMlOU1AQO%252BpCKn5e8hbjeEKCOv5aKK2fDQFnmcobRUBY4uMSqFBWawpPRM8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792632/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder/Fitter - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=706ced2b364c73edd2e7de1c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ANrgG8upPeFcm%252BOyL%253AQrKYVqU3Zlw6rjW1c7VNUQ%253D%253D%253AH4IKR%252F7uHdvcFy5ga1BsnW4%252BgJjZ9nyzQ%252BloUcaXi65st2VBQDhsmgiCKxtm2QVz%252Bu6OB9GYpGt61CtML%252BtUhEbW9ruzXulXUcTPeBB%252F1XnAQLXv6dwtFnBMH6r%252BLGLf4ZyAWdeb2fmfqVrNTq8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974932/" target="_blank"><strong>Structural Welder/Fitter - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder/Fitter - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=706ced2b364c73edd2e7de1c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ANrgG8upPeFcm%252BOyL%253AQrKYVqU3Zlw6rjW1c7VNUQ%253D%253D%253AH4IKR%252F7uHdvcFy5ga1BsnW4%252BgJjZ9nyzQ%252BloUcaXi65st2VBQDhsmgiCKxtm2QVz%252Bu6OB9GYpGt61CtML%252BtUhEbW9ruzXulXUcTPeBB%252F1XnAQLXv6dwtFnBMH6r%252BLGLf4ZyAWdeb2fmfqVrNTq8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974932/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b0fc8c73ec2a5117a01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AUcFX9xfcwOklq%252FC0%253AxXZ%252B9NZVvduwpmBJ7E5ivQ%253D%253D%253AyMDnrRSIMTl8CHBG38%252F44cSqMkYwpM2bkk0EDT3Z6P7yYlJPcfuUd7BsDBHIEo0uRQCspw13dq8IumzXvJ%252FWAe6sfwVug2glOMONQvVtCjhILVME2cQc7SDpbRQl9zXxgvnP4AGD0waEKGTVC78%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074096/" target="_blank"><strong>Pipe Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b0fc8c73ec2a5117a01&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AUcFX9xfcwOklq%252FC0%253AxXZ%252B9NZVvduwpmBJ7E5ivQ%253D%253D%253AyMDnrRSIMTl8CHBG38%252F44cSqMkYwpM2bkk0EDT3Z6P7yYlJPcfuUd7BsDBHIEo0uRQCspw13dq8IumzXvJ%252FWAe6sfwVug2glOMONQvVtCjhILVME2cQc7SDpbRQl9zXxgvnP4AGD0waEKGTVC78%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074096/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b2a98c73ec2a5117851&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AF1zl7xXPg3jfQ1a%252F%253AOlXJk4Sm8gAaKb4g%252FcCo6g%253D%253D%253AXBoyZUlvwOBgoLFlh9nbZBPUfQYcg6LPD%252FZYaV033ayvvoFCBp2JBgGx8DXFgCHpLgJuxYG62yaee09Nh4CXDE%252BD0%252Bbs0gZPWQ%252FKvNv6CVoZJw8ufSg4fy%252BiGp7dMLpu4nlwN7u24Ma%252BhGp3EKA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074123/" target="_blank"><strong>Pipe Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b2a98c73ec2a5117851&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AF1zl7xXPg3jfQ1a%252F%253AOlXJk4Sm8gAaKb4g%252FcCo6g%253D%253D%253AXBoyZUlvwOBgoLFlh9nbZBPUfQYcg6LPD%252FZYaV033ayvvoFCBp2JBgGx8DXFgCHpLgJuxYG62yaee09Nh4CXDE%252BD0%252Bbs0gZPWQ%252FKvNv6CVoZJw8ufSg4fy%252BiGp7dMLpu4nlwN7u24Ma%252BhGp3EKA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074123/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Fitter Welder - $27 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ea94d83c73ec2b47a5e21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Ad3yYxVKz8UNpMPc8%253AA3Sr5%252FPl%252BbE%252Fwzfc5F4m4Q%253D%253D%253A4zbSpckK%252BBMUJEj2WpdcL0JVjzmyvlCg5l0PA2%252FMgTOeyErcvKCy7D%252BzK2RRxnE8m9njgU7BBdNOK7UNdQU%252BHmkidAzA1HlJtljkAYPqRl1elYdX6qdmMfdA7mrPBPaHU5ztCxo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053232366/" target="_blank"><strong>Pipe Fitter Welder - $27 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Fitter Welder - $27 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ea94d83c73ec2b47a5e21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Ad3yYxVKz8UNpMPc8%253AA3Sr5%252FPl%252BbE%252Fwzfc5F4m4Q%253D%253D%253A4zbSpckK%252BBMUJEj2WpdcL0JVjzmyvlCg5l0PA2%252FMgTOeyErcvKCy7D%252BzK2RRxnE8m9njgU7BBdNOK7UNdQU%252BHmkidAzA1HlJtljkAYPqRl1elYdX6qdmMfdA7mrPBPaHU5ztCxo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053232366/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Fitter Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b09a8c73ec2a5117a61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AteqDrkD2NVS6ELJy%253AZjQP%252FHX%252FLHthg3ga2PCLqw%253D%253D%253A5jg2IelXAn3raHayqQ2AIfOo4NpRAaNpSQqJQ6zKBgCWg%252Fwd3ewss5khBXuzrQuPYjD8%252FJ%252F1dkqRyWN%252FBCkr9lSPbXQqpvAVSjsQs7OriS1I73Fj326vQuEWBNz8kfAK958QWXijeGGmfNuZau8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074090/" target="_blank"><strong>Pipe Fitter Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Fitter Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b09a8c73ec2a5117a61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AteqDrkD2NVS6ELJy%253AZjQP%252FHX%252FLHthg3ga2PCLqw%253D%253D%253A5jg2IelXAn3raHayqQ2AIfOo4NpRAaNpSQqJQ6zKBgCWg%252Fwd3ewss5khBXuzrQuPYjD8%252FJ%252F1dkqRyWN%252FBCkr9lSPbXQqpvAVSjsQs7OriS1I73Fj326vQuEWBNz8kfAK958QWXijeGGmfNuZau8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074090/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - $25 - 29/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb90d82c73ec2b47b5a21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7PceJeG2fnk1xgEF%253AS3KNSosZj79DTjj3eweQUA%253D%253D%253AUMshNAfx5AAKypnAavaCb1cl%252FiJmJvGlZuio%252Bi9lXU9RmRDjizwKH0arYop83L8xFZ%252FScumIDzAk2wfcW1lHenoezicSxMCte31LJAzoiKNVK17DB%252F7JcJy%252FzdvjOqFpIx1MeqdmLSJng%252FiV5hk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236398/" target="_blank"><strong>Structural Welder - $25 - 29/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Class A or B Welders Pay: $25-29/hr. DOE Hours: Monday- Friday 5AM-3:30PM. Job Type: Temp-Hire Location: Catoosa, Oklahoma Test_:_ 2G and 3G GMAW, FCAW. 2\" 6G Super coupon GMAW, FCAW. 2\" 6G XX GTAW. Job Description: Responsible for performing welding functions per job specifications....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - $25 - 29/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb90d82c73ec2b47b5a21&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7PceJeG2fnk1xgEF%253AS3KNSosZj79DTjj3eweQUA%253D%253D%253AUMshNAfx5AAKypnAavaCb1cl%252FiJmJvGlZuio%252Bi9lXU9RmRDjizwKH0arYop83L8xFZ%252FScumIDzAk2wfcW1lHenoezicSxMCte31LJAzoiKNVK17DB%252F7JcJy%252FzdvjOqFpIx1MeqdmLSJng%252FiV5hk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053236398/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder - $22/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ebe6362c73ec2b47b2cc1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AW6SmNrJhSOvdZQxq%253AIyqOqsyaB52f044kUMlDrg%253D%253D%253AsDKsq83HPNZc%252FbTsa9ziD4hpM2bquld5MNdWR2hPRWFFGXS3f0rcTYzHOnTaheLMNH0iptKfDcsok%252BQqL%252FEbN%252FMTzA61YdKEJhNHRp%252FNbquDjcYLFMKexM49ZePlONOTuhQZRdE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053237764/" target="_blank"><strong>Fitter Welder - $22/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Fitter Pay: $22/hr. Hours: Day Shift 6AM-4:30PM Job type: Temp to Hire Location: Sapulpa, Oklahoma Weld Test: Fitters Test Job Description: We're seeking a skilled Structural Fitter welder to ensure precise fabrication and adherence to quality and safety standards. Your responsibilities...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder - $22/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ebe6362c73ec2b47b2cc1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AW6SmNrJhSOvdZQxq%253AIyqOqsyaB52f044kUMlDrg%253D%253D%253AsDKsq83HPNZc%252FbTsa9ziD4hpM2bquld5MNdWR2hPRWFFGXS3f0rcTYzHOnTaheLMNH0iptKfDcsok%252BQqL%252FEbN%252FMTzA61YdKEJhNHRp%252FNbquDjcYLFMKexM49ZePlONOTuhQZRdE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053237764/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Field Service Technician Assistant - $15 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=70b73a23913c73eddf5aae961&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Azlul1lYBf82bzK5V%253Am9oM%252BBh%252B%252BsNeztyTpuxYuw%253D%253D%253AfKJKHUcpFiGBC5jPf43KfQjAyrAogNeF%252FK%252BfbF8Dh45G6ipb6O7gUSZiP09pO0MeYamSkx76FrU0%252FadKXV%252FJ5ZBmPskxIde%252BUUTolK4J0%252F8MKIA7MiHFQR%252BDjZIqy%252Batz3V%252BMdgLGI8BFhpOsGI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30254884826/" target="_blank"><strong>Overhead Crane Field Service Technician Assistant - $15 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Overhead Crane Field Service Technician Assistant Pay: $15-25/hr. Depending on experience Hours: 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: Join our team as an Overhead Crane Field Service Technician Assistant, where you'll play a crucial role in inspecting,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Field Service Technician Assistant - $15 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b73a23913c73eddf5aae961&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253Azlul1lYBf82bzK5V%253Am9oM%252BBh%252B%252BsNeztyTpuxYuw%253D%253D%253AfKJKHUcpFiGBC5jPf43KfQjAyrAogNeF%252FK%252BfbF8Dh45G6ipb6O7gUSZiP09pO0MeYamSkx76FrU0%252FadKXV%252FJ5ZBmPskxIde%252BUUTolK4J0%252F8MKIA7MiHFQR%252BDjZIqy%252Batz3V%252BMdgLGI8BFhpOsGI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30254884826/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b59019fd9c73eddf700d301&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AY1uyHbI4a9z7PJj5%253A34hFyM%252BTwvbCt48FNYNjDQ%253D%253D%253AKrNA2JaWVZ6ioYX48vBXCFJhYoPBimGdBOTtj4zD5fgVoPr1XB7Tqb5hviyC132kyX3FNslsZPZ6owxDxJKSYgSWLyqr0ClAPQoY%252FLC4qGhAZWgSRyczJBCw2AnDgySLNIQ%252FL2I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139776/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b59019fd9c73eddf700d301&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AY1uyHbI4a9z7PJj5%253A34hFyM%252BTwvbCt48FNYNjDQ%253D%253D%253AKrNA2JaWVZ6ioYX48vBXCFJhYoPBimGdBOTtj4zD5fgVoPr1XB7Tqb5hviyC132kyX3FNslsZPZ6owxDxJKSYgSWLyqr0ClAPQoY%252FLC4qGhAZWgSRyczJBCw2AnDgySLNIQ%252FL2I%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139776/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901e319c73eddf700d4c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5l2%252BTshAk6HOOpR5%253ARNjtJEEXwEO%252BeaIAdXOsrA%253D%253D%253Ah%252F3N1oIeBKm%252Bw4jmrr1WP4U9HipN%252FsN1VNX1398SewH9g9N%252BbIO4LVQ2U67aOYalEso09I%252FXR0vOFCdO2nrzgA%252Fc7OrABXFiMYxUr1kh1nsUN630lnJrG7bOmdRDeFlq4jeD%252B98%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139844/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $27+/hr. Hours: Friday-Sunday 6AM-6PM (Work 36 Paid 40) Job type: Temp to Hire Location: Tulsa, Oklahoma Benefits: Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901e319c73eddf700d4c1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5l2%252BTshAk6HOOpR5%253ARNjtJEEXwEO%252BeaIAdXOsrA%253D%253D%253Ah%252F3N1oIeBKm%252Bw4jmrr1WP4U9HipN%252FsN1VNX1398SewH9g9N%252BbIO4LVQ2U67aOYalEso09I%252FXR0vOFCdO2nrzgA%252Fc7OrABXFiMYxUr1kh1nsUN630lnJrG7bOmdRDeFlq4jeD%252B98%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139844/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Pipe Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901b759c73eddf700d181&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AREE%252BXK3qaUjEfyXD%253A8rC5P%252FtGYRK0yrYPmKwl9w%253D%253D%253AuTpaWgHNK1UNXRX1fwOPtlYltSJcVyD4aNxEUhf67YTwS6%252FVunqicmdM1WLSgBONRfS4VvmTk8qIa4kDfl0RN20pFG3RoQwb0ChO16mdOodSlCodVmQ1BBll%252BGEGhT2o1EeVp%252Fw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139800/" target="_blank"><strong>Pipe Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Pipe Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901b759c73eddf700d181&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AREE%252BXK3qaUjEfyXD%253A8rC5P%252FtGYRK0yrYPmKwl9w%253D%253D%253AuTpaWgHNK1UNXRX1fwOPtlYltSJcVyD4aNxEUhf67YTwS6%252FVunqicmdM1WLSgBONRfS4VvmTk8qIa4kDfl0RN20pFG3RoQwb0ChO16mdOodSlCodVmQ1BBll%252BGEGhT2o1EeVp%252Fw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139800/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter" href="https://www.jobs2careers.com/click.php?jid=701f8f0ecf6c73edd5d1fc431&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8msfo1JwwqRDnzoq%253Ahb1ftBYQHCG7XUQAGMkgOQ%253D%253D%253A65%252FnOGdUtrFcYkcP6KtUzF8IXyikgSonFcIFW7DsB94UviRN3B9XEOOVmw9ro9L8MYO3G276CzM6gPPm5O5NTb4zrY78K13sLJPy%252F8AJTnp1eiN%252FNkCqgTBGVG3VA%252BvQuPMuEs%252F%252FiF5Nhljd6rA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30095849101/" target="_blank"><strong>Structural Fitter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK </p> <p class="description">This job was posted by : For more information, please see: Fitter {#spanstylefontsize115ptcolorblackstructuralfitterspanspanstylefontsize115ptcolor666666span}Pay: \$22/hr. {#spanstylefontsize115ptcolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylefontsize115ptcolorblackd22hrspan}Hours:...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=701f8f0ecf6c73edd5d1fc431&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8msfo1JwwqRDnzoq%253Ahb1ftBYQHCG7XUQAGMkgOQ%253D%253D%253A65%252FnOGdUtrFcYkcP6KtUzF8IXyikgSonFcIFW7DsB94UviRN3B9XEOOVmw9ro9L8MYO3G276CzM6gPPm5O5NTb4zrY78K13sLJPy%252F8AJTnp1eiN%252FNkCqgTBGVG3VA%252BvQuPMuEs%252F%252FiF5Nhljd6rA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30095849101/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Technician - $25 - 35/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eca4505c73ec2b47c6ea1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkGPdzAL4IQDI4HC5%253A6eGI61l%252FDrWK%252FkAG%252FfO3Qg%253D%253D%253Auik%252F2PKvp%252ByzzaUr605%252BM1Aqj7Mczj2JtlPl6jN7%252B2ztDZwyZIOzQ0j%252FT%252FAUQp2dPR5wLv7qIKcnWjcZejWWXW9BxhtqXgkykFFfOVOH2SYEpZNd00cd7h3Zg6HTw9qgrXsSzJyC3tR8bvRXRC2b&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053240806/" target="_blank"><strong>Overhead Crane Technician - $25 - 35/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Technician - $25 - 35/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eca4505c73ec2b47c6ea1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkGPdzAL4IQDI4HC5%253A6eGI61l%252FDrWK%252FkAG%252FfO3Qg%253D%253D%253Auik%252F2PKvp%252ByzzaUr605%252BM1Aqj7Mczj2JtlPl6jN7%252B2ztDZwyZIOzQ0j%252FT%252FAUQp2dPR5wLv7qIKcnWjcZejWWXW9BxhtqXgkykFFfOVOH2SYEpZNd00cd7h3Zg6HTw9qgrXsSzJyC3tR8bvRXRC2b&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053240806/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Louver Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901c9b9c73eddf700d661&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AVn1qjzSJYVlpqqe5%253AXtEzBRfpeveVxaCjrXQrRw%253D%253D%253AEsgKsWOWm1eWKrYrKKAjtG15Mv%252FFkemUBRfC37dj31AoOpMUlKmuJqpSZtOG8BiWtozZNl8qtw6NyyPbyujWORKOaOap1Bm0PUhoMTWfuD%252F1O6vld4mz4y%252B2FQPVtZvKud7tAxg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139818/" target="_blank"><strong>Structural Louver Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Louver Welder Pay: $22+/hr (Based on experience) Hours: Monday- Friday 5PM-5:30AM Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The Structural Louver welder must have proficiency in welding fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Louver Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901c9b9c73eddf700d661&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AVn1qjzSJYVlpqqe5%253AXtEzBRfpeveVxaCjrXQrRw%253D%253D%253AEsgKsWOWm1eWKrYrKKAjtG15Mv%252FFkemUBRfC37dj31AoOpMUlKmuJqpSZtOG8BiWtozZNl8qtw6NyyPbyujWORKOaOap1Bm0PUhoMTWfuD%252F1O6vld4mz4y%252B2FQPVtZvKud7tAxg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139818/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=7162da8ebd3c73edc204a4441&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A6HCD%252BY9c4kQf550F%253AbQTC65KyIRNwwT%252FV28G%252BVA%253D%253D%253A9OE1w%252FODHO446bQa6MgdlpshPlgT2uIf3nO4Aii5Gt7lSNND%252Bdc2nSZd%252BKUgXNWzOqYlqVm5iSpILNL2G%252BwPjJoxkvdA4F6H8D%252BkHB0f%252BV1s60vnSNLYCBsHj2cUkaBNGw%252FBxHo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848396/" target="_blank"><strong>Structural Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8ebd3c73edc204a4441&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A6HCD%252BY9c4kQf550F%253AbQTC65KyIRNwwT%252FV28G%252BVA%253D%253D%253A9OE1w%252FODHO446bQa6MgdlpshPlgT2uIf3nO4Aii5Gt7lSNND%252Bdc2nSZd%252BKUgXNWzOqYlqVm5iSpILNL2G%252BwPjJoxkvdA4F6H8D%252BkHB0f%252BV1s60vnSNLYCBsHj2cUkaBNGw%252FBxHo%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848396/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder - $25 - 28/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eaf3413c73ec2b47a39b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASiwj7q2LbZOH72v4%253AgR6hyDSrfggPbEWZreZpbw%253D%253D%253AYlCV%252Bq3jFZT32IuXRKaWpOaWk%252BFNIRLcERKSR%252B09l2opZOhlwO3ImOZ2k3wvJoDj1vmQueO0ZbOAGlYjr17xQ2mrsLLuvwc3AUcNAkE5Gi8kCVkBd%252FcLtM%252B%252Bsj5zcn5p%252BP9sOPDg3QwYcxvWJ%252FA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053233877/" target="_blank"><strong>Fitter Welder - $25 - 28/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Fitter Welder Pay: $25-28+/hr. Hours: Monday-Saturday 6AM-4:30PM Job type: Temp to Hire Location: Broken Arrow, Oklahoma Weld Test: 6G Test Job Description: As a Fitter/Welder, you will play a crucial role in the production process. The ideal candidate will have a minimum of 2 years...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder - $25 - 28/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eaf3413c73ec2b47a39b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASiwj7q2LbZOH72v4%253AgR6hyDSrfggPbEWZreZpbw%253D%253D%253AYlCV%252Bq3jFZT32IuXRKaWpOaWk%252BFNIRLcERKSR%252B09l2opZOhlwO3ImOZ2k3wvJoDj1vmQueO0ZbOAGlYjr17xQ2mrsLLuvwc3AUcNAkE5Gi8kCVkBd%252FcLtM%252B%252Bsj5zcn5p%252BP9sOPDg3QwYcxvWJ%252FA%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053233877/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Overhead Crane Technician" href="https://www.jobs2careers.com/click.php?jid=6fe781aede8c73ec2a5116421&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AhJHGa%252FFL3JKZ%252FNi9%253A2kRR36b6iN3eR2aciqtBuQ%253D%253D%253AWDOTLTUDc9vPBahwJHkAJcZgtHME7o4Iv%252BmWBEfEUDStDDl%252Fz7ZznSLKKhTkPx5ehB7x%252B6L%252FVNXG2ngIIyJxt4afphbpw1vA0Py88kOR4CLj1A7A7G0J%252Fmp4BMfEiTOomO%252BWICHLajbW0FbWnHGq&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074062/" target="_blank"><strong>Overhead Crane Technician</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Overhead Crane Technician" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781aede8c73ec2a5116421&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AhJHGa%252FFL3JKZ%252FNi9%253A2kRR36b6iN3eR2aciqtBuQ%253D%253D%253AWDOTLTUDc9vPBahwJHkAJcZgtHME7o4Iv%252BmWBEfEUDStDDl%252Fz7ZznSLKKhTkPx5ehB7x%252B6L%252FVNXG2ngIIyJxt4afphbpw1vA0Py88kOR4CLj1A7A7G0J%252Fmp4BMfEiTOomO%252BWICHLajbW0FbWnHGq&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074062/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Steel Fitters/Mig Flux Welder - $18/hr" href="https://www.jobs2careers.com/click.php?jid=714ec5fc07cc73edc0c5536f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AroqtV6MxJdwZNgRi%253AoGCs8KoiZ449%252Fjp39rAfuw%253D%253D%253A14PkPXNLzDPJnj3HDmCkaMbwV%252Fsl%252FcKxqCPtVpeWVDeBGZiz4%252B2VvhXpdY1IjTAHxqvdTEss%252Bt%252BOLUrmDgBXzQd%252B%252FA%252B1YGNHsYR1lwEu6bnaqH11WxHwQ6dGju8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792609/" target="_blank"><strong>Structural Steel Fitters/Mig Flux Welder - $18/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Steel Fitters/Mig Flux Welder - $18/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fc07cc73edc0c5536f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AroqtV6MxJdwZNgRi%253AoGCs8KoiZ449%252Fjp39rAfuw%253D%253D%253A14PkPXNLzDPJnj3HDmCkaMbwV%252Fsl%252FcKxqCPtVpeWVDeBGZiz4%252B2VvhXpdY1IjTAHxqvdTEss%252Bt%252BOLUrmDgBXzQd%252B%252FA%252B1YGNHsYR1lwEu6bnaqH11WxHwQ6dGju8%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792609/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Fitter Welder" href="https://www.jobs2careers.com/click.php?jid=702a0920290c73edd6899ead1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AiP4JVamI1bJn7t9G%253AsEeoaGmazCTEBqg1ArJugA%253D%253D%253AWf%252FG8GoOBLYlIyEz6UTy1riK7C794UigAYLvaXTGNonOCezyszG2kGj5witIn5CYcke7MPe5zF%252FnQJz3hilDYH0bx423tJXHaxTH2DBV6imrheR7j3CNzA0ki%252F5y6xuTTC82xkYuRT0WU5FXJUQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30106834851/" target="_blank"><strong>Fitter Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Fitter Welder Pay: $24-$32/hr. Multiple Shifts Available Location: Sand Springs, Oklahoma Must be able to pass drug test and background check. Shifts Available: Weekends: 6:00am-6:00pm OR 6:00pm-6:00am Friday-Sunday and some weekdays. Weekdays: 6:00am-6:00pm OR 6:00pm-6:00am 1 day off during...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Fitter Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=702a0920290c73edd6899ead1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AiP4JVamI1bJn7t9G%253AsEeoaGmazCTEBqg1ArJugA%253D%253D%253AWf%252FG8GoOBLYlIyEz6UTy1riK7C794UigAYLvaXTGNonOCezyszG2kGj5witIn5CYcke7MPe5zF%252FnQJz3hilDYH0bx423tJXHaxTH2DBV6imrheR7j3CNzA0ki%252F5y6xuTTC82xkYuRT0WU5FXJUQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30106834851/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View CNC Mill & Lathe Machinist" href="https://www.jobs2careers.com/click.php?jid=6fe781b0658c73ec2a5117a91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AEYboVl6FrqSzbtPr%253Ac2tdKnAy5LM8BXRwXAFR5g%253D%253D%253AFEnpZXw1uhNHa2QkEjCnpLYhabtU9jAUUp3Os6kTRp2RxbuSVzX4d5OPtiRbt%252Fl7r0kYuvQwCWHCZZnsGVwUuSm%252FSgBTNMMY%252FyLLReHi6N2Doozl4pxwHJOt6RqeCZNxeXGQmbE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074087/" target="_blank"><strong>CNC Mill & Lathe Machinist</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View CNC Mill & Lathe Machinist" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b0658c73ec2a5117a91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AEYboVl6FrqSzbtPr%253Ac2tdKnAy5LM8BXRwXAFR5g%253D%253D%253AFEnpZXw1uhNHa2QkEjCnpLYhabtU9jAUUp3Os6kTRp2RxbuSVzX4d5OPtiRbt%252Fl7r0kYuvQwCWHCZZnsGVwUuSm%252FSgBTNMMY%252FyLLReHi6N2Doozl4pxwHJOt6RqeCZNxeXGQmbE%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074087/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=70b5901a649c73eddf700d091&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8s9itDjlP4LqslLH%253AMjUEqcCHK6hC%252BZgJIra%252Fsg%253D%253D%253AR8%252BM3V6rLmOZCIeh6fQVGLI57mkleaSTzE3piLdeJ4YeX8%252Fls4tuCFovK3a%252FFr5q3Mmrrs4ztPZrLRhay%252Fu1iXMdZGuc7K3aEeR0L11ztBXflyCW6jy%252FSdO%252FKn%252BdanBizVLs0Yw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139783/" target="_blank"><strong>Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=70b5901a649c73eddf700d091&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8s9itDjlP4LqslLH%253AMjUEqcCHK6hC%252BZgJIra%252Fsg%253D%253D%253AR8%252BM3V6rLmOZCIeh6fQVGLI57mkleaSTzE3piLdeJ4YeX8%252Fls4tuCFovK3a%252FFr5q3Mmrrs4ztPZrLRhay%252Fu1iXMdZGuc7K3aEeR0L11ztBXflyCW6jy%252FSdO%252FKn%252BdanBizVLs0Yw%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30253139783/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder - $25/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6eb009c2c73ec2b47bca61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AypofVI%252FlG8rGCMlY%253Apkv1m3DJzJmyg4nEUJEbaA%253D%253D%253AIZtGv0qi9heznsszKV6AidmiPkI0StYr%252F4VND0BZs1yYyvXiesIIRu%252FPDSNLAGbYNKnpRV6QfOdSUxna%252FdUkQIRtSeQrnVR6kwkgVcE3Wr5eO3CvyGD6itTI6%252Bz1iDDOaW19qPg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053234090/" target="_blank"><strong>Structural Fitter / Welder - $25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder - $25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6eb009c2c73ec2b47bca61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AypofVI%252FlG8rGCMlY%253Apkv1m3DJzJmyg4nEUJEbaA%253D%253D%253AIZtGv0qi9heznsszKV6AidmiPkI0StYr%252F4VND0BZs1yYyvXiesIIRu%252FPDSNLAGbYNKnpRV6QfOdSUxna%252FdUkQIRtSeQrnVR6kwkgVcE3Wr5eO3CvyGD6itTI6%252Bz1iDDOaW19qPg%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053234090/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View CNC Mill & Lathe Machinist - $20 - 25/hr" href="https://www.jobs2careers.com/click.php?jid=6ff6ea70633c73ec2b47aba91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8EcB9ToIa%252BZcABDF%253AuZv%252FH6sQ4Hfdy8RjJOejqQ%253D%253D%253AoaKX5x4WuiFA2SlmH47rmgxMc7%252BCPnoplkocTIrfS0jmOSt0lCB6dPB262UTbsLk6j7geGkcpkDYm8IN1YRtBI8Pxxll3b3ej60yLuyPvmv5W8taS2hJfIhwTQA%252F9EpY9pfK1KMVJKelVQwZDg%252BD&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053231783/" target="_blank"><strong>CNC Mill & Lathe Machinist - $20 - 25/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View CNC Mill & Lathe Machinist - $20 - 25/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6ff6ea70633c73ec2b47aba91&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A8EcB9ToIa%252BZcABDF%253AuZv%252FH6sQ4Hfdy8RjJOejqQ%253D%253D%253AoaKX5x4WuiFA2SlmH47rmgxMc7%252BCPnoplkocTIrfS0jmOSt0lCB6dPB262UTbsLk6j7geGkcpkDYm8IN1YRtBI8Pxxll3b3ej60yLuyPvmv5W8taS2hJfIhwTQA%252F9EpY9pfK1KMVJKelVQwZDg%252BD&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30053231783/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder/Fitter" href="https://www.jobs2careers.com/click.php?jid=706ced2a504c73edd2e7de0a1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ApNJumapE7wSRGwC8%253AFOkauSG0B%252FRtLxgH%252BqdOBg%253D%253D%253AoOjjcFIkjYJEv1Qbi%252Flp3QX9I6wkDIQhc1tZKdfVHW%252B0bjDX9xHH02PaZaAr3tCpm%252B4%252FDYNYEKd6GLtrlOezqOb0Dq%252BMiHrQm9KSt6KuoorQe4gRtme6eMe15XAr%252F%252FZZ6Id8Kj4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974918/" target="_blank"><strong>Structural Welder/Fitter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 7 days ago </p> <p class="description">Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder/Fitter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=706ced2a504c73edd2e7de0a1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ApNJumapE7wSRGwC8%253AFOkauSG0B%252FRtLxgH%252BqdOBg%253D%253D%253AoOjjcFIkjYJEv1Qbi%252Flp3QX9I6wkDIQhc1tZKdfVHW%252B0bjDX9xHH02PaZaAr3tCpm%252B4%252FDYNYEKd6GLtrlOezqOb0Dq%252BMiHrQm9KSt6KuoorQe4gRtme6eMe15XAr%252F%252FZZ6Id8Kj4%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30176974918/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Mill Machinist" href="https://www.jobs2careers.com/click.php?jid=711981a5218c73edc5b116fd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Aw9bR02i4qs%252BI05cV%253AvVbQ1fJBCscpzvkGP%252BucBw%253D%253D%253AAVLr3B8E37kd4AyTcU6Lu2gDd5roM%252FHz%252F2H8niE%252BEaDGxNGqTfdlopDTyoork7Yvh8jbhRKsh5ECErUfcohgWNH851iWwpx9EzpRuA3GnHmmUwXhCCcJxuLzlsxPLZ5tgZ2u6m0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30357938163/" target="_blank"><strong>Mill Machinist</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Claremore, OK </p> <p class="description">This job was posted by : For more information, please see: Machinist Pay: \$19/hr +. DOE Hours: Friday- Sunday 6AM-4PM OR 5PM- 3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Will set up and operate planner type milling machine that moves work piece back and forth against rigidly...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Mill Machinist" target="_blank" href="https://www.jobs2careers.com/click.php?jid=711981a5218c73edc5b116fd1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Aw9bR02i4qs%252BI05cV%253AvVbQ1fJBCscpzvkGP%252BucBw%253D%253D%253AAVLr3B8E37kd4AyTcU6Lu2gDd5roM%252FHz%252F2H8niE%252BEaDGxNGqTfdlopDTyoork7Yvh8jbhRKsh5ECErUfcohgWNH851iWwpx9EzpRuA3GnHmmUwXhCCcJxuLzlsxPLZ5tgZ2u6m0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30357938163/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1ed8c73ec2a5117b11&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkIBNfVGSyi0PK93e%253AHF9G5NNfQ7MTl71W8%252BuFYw%253D%253D%253Ats3Wym383tMnA35y9WUonagdwsEUpT%252FL7a4zgThNgHl8eqrxuakAzHVYqfJUmY63eIp10oJBdj%252BMIEb%252FeqGA%252BOhlpPd%252BEa1cPm%252FtfOgyH%252BxPmH3xVjdv1jc5gpCW2%252BYY2zby6pHVzlLgyROgju0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074111/" target="_blank"><strong>Structural Fitter / Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Fitter / Welder Pay: $21-23/hr. Hours: Monday- Friday 6AM-4:30PM Job Type:Temp-Hire Location: Tulsa, Ok Benefits: 401k, 401k Matching, Dental insurance, Health insurance, Paid time off and Vision insurance. Job Description: Must pass an Mig and flux core 3G weld test on a...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1ed8c73ec2a5117b11&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkIBNfVGSyi0PK93e%253AHF9G5NNfQ7MTl71W8%252BuFYw%253D%253D%253Ats3Wym383tMnA35y9WUonagdwsEUpT%252FL7a4zgThNgHl8eqrxuakAzHVYqfJUmY63eIp10oJBdj%252BMIEb%252FeqGA%252BOhlpPd%252BEa1cPm%252FtfOgyH%252BxPmH3xVjdv1jc5gpCW2%252BYY2zby6pHVzlLgyROgju0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074111/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=716a7a270c3c73edc28eaedf1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AaPHDSfz98BsWOgym%253Alc8qUXizzfKBqxYfJhJzYg%253D%253D%253AwvujnOri15OW6Bdv%252FiMTkWglJo1i9%252FoubCufQIXkV%252B2BHFn1YFQMljYCu6QBY1IQ5O35GEPA8QWmCJCx9yVcbCb4snG9PVDaow%252FMHOWCYMNgUMRLn2wGxiqUzpamPUVjyz3UjyI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30442842129/" target="_blank"><strong>Structural Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 4 days ago </p> <p class="description">Structural Welder Pay: $26-27/hr. Hours: 5AM-4:30PM OR 5PM-4:30AM Job Type: Temp to Hire Location: North Owasso, Oklahoma Job Description: The Structural Welder performs welding tasks accurately and efficiently to meet project deadlines and quality expectations. Work autonomously with...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=716a7a270c3c73edc28eaedf1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AaPHDSfz98BsWOgym%253Alc8qUXizzfKBqxYfJhJzYg%253D%253D%253AwvujnOri15OW6Bdv%252FiMTkWglJo1i9%252FoubCufQIXkV%252B2BHFn1YFQMljYCu6QBY1IQ5O35GEPA8QWmCJCx9yVcbCb4snG9PVDaow%252FMHOWCYMNgUMRLn2wGxiqUzpamPUVjyz3UjyI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30442842129/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1cf8c73ec2a5117b31&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AH5foOXMA274ovXdr%253A1jQat9vy0nXapFnVgAKrNQ%253D%253D%253AoNhOgbXB9rZtJJuSruKD4X8lvy3Dw5sH%252BWqyYuox6INl%252BlI0t6SwLwkJbbuKop0YfQD6yRQjPAS66ufl78t7Iow1ktXU48y5FWQj7C0ZYAm4Fv1T7oZk0EV%252Br2WKxEJLZDqjiUCZfvxrDBmY%252FtI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074109/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1cf8c73ec2a5117b31&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AH5foOXMA274ovXdr%253A1jQat9vy0nXapFnVgAKrNQ%253D%253D%253AoNhOgbXB9rZtJJuSruKD4X8lvy3Dw5sH%252BWqyYuox6INl%252BlI0t6SwLwkJbbuKop0YfQD6yRQjPAS66ufl78t7Iow1ktXU48y5FWQj7C0ZYAm4Fv1T7oZk0EV%252Br2WKxEJLZDqjiUCZfvxrDBmY%252FtI%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074109/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=7162da8dbd3c73edc204a4741&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASQ5%252FOayUGwJWXTWA%253AOsFMyA4hmoPoOd3QQ2tDcA%253D%253D%253AXEjaL2EPN%252FYYCSYWgaui3uiBt%252BFo0V0rdLqhwyBjcdFkBAVMD%252FXhs3CJYaLU%252B4hIAH0V0ZEwwJJolKW5RUSHSFrDi%252F%252BjLljmW4AlXIcl5B57GtDC6Q9a0KTOYoUZB78tkfKCjaoCwDTJiT%252FZbKQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848380/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 5 days ago </p> <p class="description">Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=7162da8dbd3c73edc204a4741&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ASQ5%252FOayUGwJWXTWA%253AOsFMyA4hmoPoOd3QQ2tDcA%253D%253D%253AXEjaL2EPN%252FYYCSYWgaui3uiBt%252BFo0V0rdLqhwyBjcdFkBAVMD%252FXhs3CJYaLU%252B4hIAH0V0ZEwwJJolKW5RUSHSFrDi%252F%252BjLljmW4AlXIcl5B57GtDC6Q9a0KTOYoUZB78tkfKCjaoCwDTJiT%252FZbKQ%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30434848380/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Welder" href="https://www.jobs2careers.com/click.php?jid=703081ae038c73edd721164f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ADWA%252Bh4yQ%252BmIRx%252BVR%253A0Ibmg5FvRoCgTyC0Hg%252FDrw%253D%253D%253AmbP5aXQbJKIABIma4%252BYuu5JncUt1Yhfs63mlrWZi%252BbXUJ3JjwZrB0B45FeqvRxLnhtkKQVaWq4%252FzsfnA05yXLjXdwB8HfhKtlyc201DbjTWwlAihsxoRKik2zFA5me0ink%252B9Aw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30113620097/" target="_blank"><strong>Structural Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - Yesterday </p> <p class="description">Structural Welder Pay: $18-22/hr. Hours: 6AM-4:30PM Job type: Temp to Hire Location: Owasso, Oklahoma Weld Test: 3G and 4G Mig Flux Core Job Description: As a Structural Welder with 3G and 4G, you will play a crucial role in the fabrication and assembly of various structural components....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=703081ae038c73edd721164f1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ADWA%252Bh4yQ%252BmIRx%252BVR%253A0Ibmg5FvRoCgTyC0Hg%252FDrw%253D%253D%253AmbP5aXQbJKIABIma4%252BYuu5JncUt1Yhfs63mlrWZi%252BbXUJ3JjwZrB0B45FeqvRxLnhtkKQVaWq4%252FzsfnA05yXLjXdwB8HfhKtlyc201DbjTWwlAihsxoRKik2zFA5me0ink%252B9Aw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30113620097/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Steel Fitters/Mig Flux Welder" href="https://www.jobs2careers.com/click.php?jid=714ec5fb43cc73edc0c5531b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AeSaUPeke5UUA17s0%253ADIjsOaICftxfpUaB9iZYXg%253D%253D%253AmRzC8B5hSS2b4Rm62gxpBerlPlB0oKVYPRdt9E3DI91aKuWJJZGAYL630QAzWwuVzAOKv%252FxEljBJ%252FtbcWXVW%252BRiKUZM80d1suovtzqN%252B%252F4Y63BmKFoOUN2DCsHp%252FcXzQfMlbysGkHOc4dCEDqp0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792597/" target="_blank"><strong>Structural Steel Fitters/Mig Flux Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Steel Fitters/Mig Flux Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=714ec5fb43cc73edc0c5531b1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AeSaUPeke5UUA17s0%253ADIjsOaICftxfpUaB9iZYXg%253D%253D%253AmRzC8B5hSS2b4Rm62gxpBerlPlB0oKVYPRdt9E3DI91aKuWJJZGAYL630QAzWwuVzAOKv%252FxEljBJ%252FtbcWXVW%252BRiKUZM80d1suovtzqN%252B%252F4Y63BmKFoOUN2DCsHp%252FcXzQfMlbysGkHOc4dCEDqp0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30413792597/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder - $25 - 30/hr" href="https://www.jobs2careers.com/click.php?jid=717d83a3fcac73edc3f136901&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5KFz4bmsYr7PM%252FQh%253AYs9vX2wQqYXMW%252Bml2OqTrw%253D%253D%253AKL62fk%252Ft2AVigBcKVeBRPmQBqTTS%252F4dpzbOltxQSs%252B4hj4bCoro08huZBG5o1vWxVnsQE5gCT9I5NQjGC4sJT2wbvpgHPwc3xklquuk%252Bh4e4UZuIAGqNxlmtzBT5OSVsEuk0Pyk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803936/" target="_blank"><strong>Robotic Welder - $25 - 30/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder - $25 - 30/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a3fcac73edc3f136901&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A5KFz4bmsYr7PM%252FQh%253AYs9vX2wQqYXMW%252Bml2OqTrw%253D%253D%253AKL62fk%252Ft2AVigBcKVeBRPmQBqTTS%252F4dpzbOltxQSs%252B4hj4bCoro08huZBG5o1vWxVnsQE5gCT9I5NQjGC4sJT2wbvpgHPwc3xklquuk%252Bh4e4UZuIAGqNxlmtzBT5OSVsEuk0Pyk%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803936/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Structural Fitter / Welder" href="https://www.jobs2careers.com/click.php?jid=6fe781b1128c73ec2a5117be1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AifDibtNGqltWkVK%252F%253AkvUWBtBvuRdFOPxl1oMYRQ%253D%253D%253AWSELE4uQbhVtdvteOOvY7FHnCty%252FHgR69ndr6vVPMoB8coSnnO6336PwS8xX8nlb11ove1dq%252BZLUyn99RQeJWMw4OQC7fuy9xQS6qHCWi%252FUtc4vHdq%252B8Ul1mJ0%252FHImiNRHs8oCM%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074098/" target="_blank"><strong>Structural Fitter / Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Structural Fitter / Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b1128c73ec2a5117be1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AifDibtNGqltWkVK%252F%253AkvUWBtBvuRdFOPxl1oMYRQ%253D%253D%253AWSELE4uQbhVtdvteOOvY7FHnCty%252FHgR69ndr6vVPMoB8coSnnO6336PwS8xX8nlb11ove1dq%252BZLUyn99RQeJWMw4OQC7fuy9xQS6qHCWi%252FUtc4vHdq%252B8Ul1mJ0%252FHImiNRHs8oCM%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074098/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Traveling Field Service Fitter Welder - $28 - 30/hr" href="https://www.jobs2careers.com/click.php?jid=717d83a48bac73edc3f136e71&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AHHeQb4e1NYA5w0M5%253AHIz1sL7apzB1LWU4xhrd8g%253D%253D%253AX5FD99ly3Cz0lKc1sTtEN6KsvPTtss6zDXxyEzTxcFG9s8WW%252Bj8EKBKma2vwcvReGVHyp3FQlg7iecerB1tGlgTun%252FO%252B%252FD2WrhUQ%252FCVeOX58VHWEIuyup0LxoOXY9qGl1r7Zkv0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803945/" target="_blank"><strong>Traveling Field Service Fitter Welder - $28 - 30/hr</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Traveling Field Service Fitter Welder - $28 - 30/hr" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a48bac73edc3f136e71&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AHHeQb4e1NYA5w0M5%253AHIz1sL7apzB1LWU4xhrd8g%253D%253D%253AX5FD99ly3Cz0lKc1sTtEN6KsvPTtss6zDXxyEzTxcFG9s8WW%252Bj8EKBKma2vwcvReGVHyp3FQlg7iecerB1tGlgTun%252FO%252B%252FD2WrhUQ%252FCVeOX58VHWEIuyup0LxoOXY9qGl1r7Zkv0%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803945/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Traveling Field Service Fitter Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=717d83a49aac73edc3f136e61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7sHzBVBSeVP7nTLL%253AnOE%252BSijuJf7tRMWb6%252FjeZg%253D%253D%253Am0HIinDyjJI2yv1krBAUjYG22ctIljvdOcxpN0Dab2F4Gm%252F6nptIeek7VnKrnNSBQSMy%252BVxQuIGu%252FGj60jrqmoJafint94vHNQCoo%252BI9ApuqBJ0tQfKG329blwzqOGvAjMYtq6A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803946/" target="_blank"><strong>Traveling Field Service Fitter Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Traveling Field Service Fitter Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a49aac73edc3f136e61&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253A7sHzBVBSeVP7nTLL%253AnOE%252BSijuJf7tRMWb6%252FjeZg%253D%253D%253Am0HIinDyjJI2yv1krBAUjYG22ctIljvdOcxpN0Dab2F4Gm%252F6nptIeek7VnKrnNSBQSMy%252BVxQuIGu%252FGj60jrqmoJafint94vHNQCoo%252BI9ApuqBJ0tQfKG329blwzqOGvAjMYtq6A%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803946/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder - Referral Bonus Available" href="https://www.jobs2careers.com/click.php?jid=717d83a430ac73edc3f136ec1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AI4hYNPXrYO8Yx2Rz%253AcjyY9QBAjBKEdOZv0ycSZQ%253D%253D%253Au05shHupWvXq5vg%252BcsTX8yfNTKto%252BxfuPlBA70MUdXHnQcGBaxwsLVdM%252FQ5gN0iq%252BNPPgZxp5nfkEohNFYGf%252FoEBDCy84FlySWo3qj9WwCvoN9KVEjawnwn%252BkWLXHV5S6Le9Px4jiTGTr1r7Lvs%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803940/" target="_blank"><strong>Robotic Welder - Referral Bonus Available</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder - Referral Bonus Available" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a430ac73edc3f136ec1&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AI4hYNPXrYO8Yx2Rz%253AcjyY9QBAjBKEdOZv0ycSZQ%253D%253D%253Au05shHupWvXq5vg%252BcsTX8yfNTKto%252BxfuPlBA70MUdXHnQcGBaxwsLVdM%252FQ5gN0iq%252BNPPgZxp5nfkEohNFYGf%252FoEBDCy84FlySWo3qj9WwCvoN9KVEjawnwn%252BkWLXHV5S6Le9Px4jiTGTr1r7Lvs%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803940/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="new-post"> <b>New</b> 3 hours ago </div> <div class="cl"> </div> <h2> <a class="job-link blue-link" title="View Powder Coating Painter" href="https://www.jobs2careers.com/click.php?jid=716965f4a7cc73edc2bf53e51&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Ao31GVH5Y1fnzcsYf%253AWweuknErSVWaJeIeeWWedQ%253D%253D%253AB3D82UqOnqddkUOgFb3eOOW4XXtJleToleG1kGWFHqLe1gu2MjzqC%252BXvgB2AdQviI1YAWOjYIv1SlyV5GKYWPswqkXPWQOH3bE54NI%252BSAIuQ1O6u5pCiixXLJROfiddv9QecD9PekG6IkZuqMg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30441710827/" target="_blank"><strong>Powder Coating Painter</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Claremore, OK </p> <p class="description">This job was posted by : For more information, please see: Coating Painter Pay: \$18-19/hr. Hours: Monday-Friday Day Shift Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Abrades surfaces of metal or hard composition objects to remove adhering scale, sand, paint, grease, tar, rust,...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Powder Coating Painter" target="_blank" href="https://www.jobs2careers.com/click.php?jid=716965f4a7cc73edc2bf53e51&ri=9c15632ac8944913bc818aee85506c29&job_loc=Claremore%2COK&q=&spl=v1%253Ao31GVH5Y1fnzcsYf%253AWweuknErSVWaJeIeeWWedQ%253D%253D%253AB3D82UqOnqddkUOgFb3eOOW4XXtJleToleG1kGWFHqLe1gu2MjzqC%252BXvgB2AdQviI1YAWOjYIv1SlyV5GKYWPswqkXPWQOH3bE54NI%252BSAIuQ1O6u5pCiixXLJROfiddv9QecD9PekG6IkZuqMg%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30441710827/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Robotic Welder" href="https://www.jobs2careers.com/click.php?jid=717d83a3deac73edc3f136921&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkW5UHUyHsc3ZavSI%253AOMGEzOeKhLqR7ALPqybvTg%253D%253D%253AJt%252B6Q5tp99C3Yd3t7x6DJ%252BmiTtERHMoNWV0SKq9u%252F292xEv0R6jxcAYbCd3l9yN1iRlpy1%252BWGEGxrIqYD4dAnYv6AY8yvdNUqYCtQr6DeU6vfdtyaSFtizEBHraF4dLIUUR0dw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803934/" target="_blank"><strong>Robotic Welder</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 2 days ago </p> <p class="description">Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Robotic Welder" target="_blank" href="https://www.jobs2careers.com/click.php?jid=717d83a3deac73edc3f136921&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253AkW5UHUyHsc3ZavSI%253AOMGEzOeKhLqR7ALPqybvTg%253D%253D%253AJt%252B6Q5tp99C3Yd3t7x6DJ%252BmiTtERHMoNWV0SKq9u%252F292xEv0R6jxcAYbCd3l9yN1iRlpy1%252BWGEGxrIqYD4dAnYv6AY8yvdNUqYCtQr6DeU6vfdtyaSFtizEBHraF4dLIUUR0dw%253D%253D&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30462803934/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row list-item"> <div class="col-xs-12 col-sm-10 col-md-10 col-lg-11"> <div class="date"> <div class="cl"> </div> </div> <h2> <a class="job-link blue-link" title="View Header Sub Arc/ Lance Operator" href="https://www.jobs2careers.com/click.php?jid=6fe781b2b88c73ec2a5117841&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ArAEKL5tsicrJ%252BUYn%253Ay6zCf%252FWjGVpPp8eoEuGCYA%253D%253D%253A7JXd%252BlrtAAU9OErOfOMLdBMy4a8ARroAEHPooAYKMjtSbA5MjVvMkdsxuBhpplPgEOiLdrAvtV6x9IR8LOY5LiqMXD8VUUk7V907566wGzBNFh9m4CpGEzaxePZP02Mlv5duAIQ1PaIYLYpAQrs4&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074124/" target="_blank"><strong>Header Sub Arc/ Lance Operator</strong></a> </h2> <p class="details"> <a href="#" title="View jobs by Stand-By Personnel" class="company-link sh-job">Stand-By Personnel</a> - Tulsa, OK - 1 week ago </p> <p class="description">Header Sub Arc/ Lance Operator Pay: $19+/hr. (Depending on experience) Hours: 5PM-5:30AM Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: 1G Saw Plate Sub-Arc and 2G Plate Test (3years of experience required) Job Description: The ideal candidate will possess the ability...</p> </div> <div class="hidden-xs col-sm-2 col-md-2 col-lg-1 text-right"> <div class="logo"> <a class="job-link" title="View Header Sub Arc/ Lance Operator" target="_blank" href="https://www.jobs2careers.com/click.php?jid=6fe781b2b88c73ec2a5117841&ri=9c15632ac8944913bc818aee85506c29&job_loc=Tulsa%2COK&q=&spl=v1%253ArAEKL5tsicrJ%252BUYn%253Ay6zCf%252FWjGVpPp8eoEuGCYA%253D%253D%253A7JXd%252BlrtAAU9OErOfOMLdBMy4a8ARroAEHPooAYKMjtSbA5MjVvMkdsxuBhpplPgEOiLdrAvtV6x9IR8LOY5LiqMXD8VUUk7V907566wGzBNFh9m4CpGEzaxePZP02Mlv5duAIQ1PaIYLYpAQrs4&encrypt=0&l=tulsa&t=simplyhired.com&jobkey-30037074124/"> </a> </div> <div class="candidate-response"> </div> </div> </div> <div class="row bottom-row"> <div class="col-xs-12 text-center"> <nav> <ul class="pagination"> <li class="prev"><a href="/jobs/search/tulsa?q=&page=13&sort=relevance" rel="prev">«</a></li><li><a href="/jobs/search/tulsa?q=&page=10&sort=relevance" currentLink="1">10</a></li><li><a href="/jobs/search/tulsa?q=&page=11&sort=relevance" currentLink="1">11</a></li><li><a href="/jobs/search/tulsa?q=&page=12&sort=relevance" currentLink="1">12</a></li><li><a href="/jobs/search/tulsa?q=&page=13&sort=relevance" currentLink="1">13</a></li><li class="active"><a>14</a></li><li><a href="/jobs/search/tulsa?q=&page=15&sort=relevance" currentLink="1">15</a></li><li><a href="/jobs/search/tulsa?q=&page=16&sort=relevance" currentLink="1">16</a></li><li><a href="/jobs/search/tulsa?q=&page=17&sort=relevance" currentLink="1">17</a></li><li class="next"><a href="/jobs/search/tulsa?q=&page=15&sort=relevance" rel="next">»</a></li> </ul> </nav> </div> </div> </div> </div> </div> </div> <div class="col-xs-12 col-md-3 hidden-sm voffset4"> <div class="iphone" style="border-bottom: 1px solid #231F20;"> <img src="/css/images/branding/worker_half_phone.png" class="center-block" /> </div> <p class="text-center"> Download our award winning mobile app and apply on the go. </p> <div class="row"> <div class="col-lg-6" style="margin-bottom:15px;"> <a href="/candidates/app" target="_blank" title="Download the iPhone App"> <img src="/css/images/App_Store_available.png" width="112" class="center-block" /> </a> </div> <div class="col-lg-6" style="margin-bottom:15px;"> <a href="/candidates/app/google" target="_blank" title="Download the Android App"> <img src="/css/images/google_play_badge.png" width="112" class="center-block" /> </a> </div> </div> <div class="panel panel-default voffset3"> <div class="panel-heading"> <strong>Jobs by City in Oklahoma</strong> </div> <div class="panel-body"> <ul class="list-unstyled"> <li><a href="/jobs/search/lawton" title="Jobs in Lawton">Lawton</a></li> <li><a href="/jobs/search/northwest-ok" title="Jobs in Northwest OK">Northwest OK</a></li> <li><a href="/jobs/search/oklahoma-city" title="Jobs in Oklahoma City">Oklahoma City</a></li> <li><a href="/jobs/search/stillwater" title="Jobs in Stillwater">Stillwater</a></li> <li><a href="/jobs/search/tulsa" title="Jobs in Tulsa">Tulsa</a></li> </ul> </div> </div> <div class="center-block voffset3"> <h4 class="text-center"><strong>Need to Hire?</strong></h4> <a onclick="javascript:showAcquiredModal()" title="Post a Job" class="red-btn request-demo">Get Started Now ⟶</a> <div class="clearfix"></div> </div> </div> </div> </div> </div> <div id="smb-landing-page"> <div class="light-gray-container bottom-menu"> <div class="container"> <div class="row voffset6 voffset6-bottom"> <div class="col-sm-3 col-sm-offset-0 col-xs-6"> <h4>Proven</h4> <ul class="list-unstyled voffset3"> <li><a href="/pages/ourStory" title="Our Story">Our Story</a></li> <li><a href="http://blog.proven.com" title="Blog">Blog</a></li> <li><a href="http://blog.proven.com/small-business-war-stories-podcast" title="Podcast">Podcast</a></li> <li><a href="/pages/press" title="Our Story">Press</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>For Job Seekers</h4> <ul class="list-unstyled voffset3"> <li><a href="/jobs" title="Search Jobs">Search Jobs</a></li> <li><a href="/candidates/app" title="Mobile App">Mobile App</a></li> <li><a href="/workers/join" title="Sign Up">Sign Up</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>For Employers</h4> <ul class="list-unstyled voffset3"> <li><a onclick="javascript:showAcquiredModal()" title="Post a Job for Free">Get Started</a></li> <li><a href="/pages/features" title="Features">Features</a></li> <li><a href="/pricing" title="Pricing">Pricing</a></li> <li><a href="/job-boards" title="Job Boards">Job Boards</a></li> <li><a href="https://blog.proven.com/proven-support">FAQ</a></li> </ul> </div> <div class="col-sm-3 col-xs-6"> <h4>Contact Us</h4> <ul class="list-unstyled voffset3"> <li><a href="/pages/contactUs" title="Email Us">Email Us</a></li> </ul> </div> </div> <div class="row"> <div class="col-sm-12 text-center"> <p><img src="/css/images/proven-logo.jpg" width="80" /></p> <p>We ♥ small businesses :-)</p> </div> <div class="col-sm-12 voffset4 bottom-panel text-center-xs"> <a href="http://www.facebook.com/pages/Provencom/352429835157" title="Facebook"><img src="/css/images/adcampaign/facebook.png" alt="Facebook" width="20" height="18" /></a> <a href="http://twitter.com/provenjobs" title="Twitter"><img src="/css/images/adcampaign/twitter.png" alt="Twitter" width="20" height="18" /></a> <ul class="list-inline list-unstyled voffset1"> <li>Copyright © 2024 Proven</li> <li>|</li> <li><a href="/pages/privacyPolicy" title="Privacy Policy">Privacy Policy</a></li> <li>|</li> <li><a href="/pages/termsCompanies" title="Terms of Service">Terms of Service</a></li> </ul> </div> </div> </div> </div> <!-- ACQUIRED MODAL START BELOW --> <link href="https://fonts.googleapis.com/css?family=Khula:300,400,600,700" rel="stylesheet"> <script type="text/javascript"> function showAcquiredModal() { $("#acquiredModal").modal("show"); } function hideAcquiredModal() { $("#acquiredModal").modal("hide"); } </script> <!-- ACQUIRED MODAL DIALOG --> <style> #acquiredModal { font-family: Khula,sans-serif; font-size:15px; line-height: 1.5; } #acquiredModal strong, #acquiredModal a, #acquiredModal p, #acquiredModal li { font-family: Khula,sans-serif; font-size:15px; } #acquiredModal a { color: #0076B8; } #acquiredModal li { text-align: justify; list-style-type: disc; margin-left:40px; } #acquiredModal a:visited { color: #3FB1E5; } #acquiredModal a:hover { color: #23315E; } #acquiredModal a:active { color: #0076B8; } #acquiredModal p { color: #666; font-weight: 400; width: 100%; margin: 0 0 1em; text-align: justify; } #acquiredModal .modal-footer { text-align: center; border-top: 0px solid #e5e5e5; } #acquiredModal .modal-header { border-bottom: 0px solid #e5e5e5; } @media only screen and (max-device-width: 640px){ #acquiredModal .modal-body { overflow-y: scroll; width: 100%; padding: 10px 20px !important; } } #acquiredModal .modal-content { -webkit-border-radius: 0px !important; -moz-border-radius: 0px !important; border-radius: 0px !important; } .fbimgbg { opacity: 0.5; filter: alpha(opacity=50); /* For IE8 and earlier */ } </style> <div id="acquiredModal" class="modal" tabindex="-1" role="dialog"> <div class="modal-dialog letter-width modal-lg" role="document"> <div class="modal-content"> <div class="modal-header" style="height:0"> <button type="button" class="close" data-dismiss="modal" aria-label="Close"> <span aria-hidden="true">×</span> </button> </div> <div class="modal-body" style="padding:30px 70px;"> <p style="font-size:21px;">Dear Proven Customer,</p> <p style="">Good news!</p> <p>Proven has been acquired and is joining forces with <a href="https://www.upward.net/employer/">Upward.net</a>.</p> <p>Over the past few months, the <a href="https://www.upward.net/employer/">Upward.net</a> technology team has been hard at work integrating some of the Proven features that you have grown accustomed to into the Proven platform.</p> <p>Our objective is to combine the Proven features with the <a href="https://www.upward.net/employer/">Upward.net</a> job distribution platform so that you can get even more candidates and have more flexibility than before.</p> <p>Here are a few things you should know.</p> <div><u>Logistical Details</u></div> <ul style="margin-bottom:1em"> <li>Your Proven account has been ported over to <a href="https://www.upward.net/employer/">Upward.net</a> (employer section)</li> <li>All of your historical information will be there</li> <li>Your username and credentials will remain the same, just log into <a href="https://www.upward.net/employer/">Upward.net</a> with your Proven username and password</li> <li>As of August 15th, you can post jobs on <a href="https://www.upward.net/employer/">Upward.net</a></li> <li>You will no longer be able to log into <a href="https://www.proven.com">Proven.com</a> directly</li> <li>If you have forgotten your Proven password, you can reset it by going <a href="https://www.upward.net/employer/">here</a> and following the 'forgot password' instructions and sign in</li> </ul> <p>If you have any questions about the transition, Upward.net's functionality or pricing, please contact us at <a href="mailto:support@upward.net">support@upward.net</a> or use the web chat functionality at <a href="https://www.upward.net/employer/">Upward.net</a>.</p> <p>We are tremendously grateful to the thousands of customers who have helped us succeed over the past decade. We could not have done this without you...Thank you!</p> <p></p> </div> <div class="modal-footer"> <div class="row"> <div class="col-sm-6 col-sm-offset-3"> <a href="https://www.upward.net/employer/" class="btn btn-warning btn-lg btn-block" style="color:#fff;padding-bottom:4px; margin-bottom:10px;">Login to Upward</a> </div> </div> </div> </div> </div> </div> </div>' $scripts_for_layout = '<link rel="stylesheet" type="text/css" href="/css/smoothness/jquery-ui-1.12.0.min.css?1619372464" /><script type="text/javascript" src="/js/jquery/jquery.ba-bbq-1.3.js?1619372466"></script><script type="text/javascript" src="/js/jquery/jquery.blockUI.2.66.js?1619372466"></script><script type="text/javascript" src="/js/jquery/jquery-ui-1.12.0.min.js?1619372465"></script><script type="text/javascript" src="/js/Views/Jobs/search_jobs.js?1619372465"></script>' $no_title_bar = false $no_bottom_bar = false
filemtime - [internal], line ?? include - APP/View/Layouts/responsive.ctp, line 69 View::_evaluate() - CORE/Cake/View/View.php, line 961 View::_render() - CORE/Cake/View/View.php, line 923 View::renderLayout() - CORE/Cake/View/View.php, line 546 View::render() - CORE/Cake/View/View.php, line 481 Controller::render() - CORE/Cake/Controller/Controller.php, line 960 JobsController::search() - APP/Controller/JobsController.php, line 763 ReflectionMethod::invokeArgs() - [internal], line ?? Controller::invokeAction() - CORE/Cake/Controller/Controller.php, line 490 Dispatcher::_invoke() - CORE/Cake/Routing/Dispatcher.php, line 193 Dispatcher::dispatch() - CORE/Cake/Routing/Dispatcher.php, line 167 [main] - APP/webroot/index.php, line 118
Uber - Austin - 22 hours ago
$18.10 an hour - Part-time Drive with Uber and help your community get around town. Driving with Uber is a great way to earn extra money when you need it. It’s flexible and works with your schedule. And now, when you register for Instant Pay, you can get paid to your debit card up to 5x daily....
Stand-By Personnel - Tulsa, OK - 1 week ago
Weekend Sub Arc Welder Pay: $19+/hr. Hours: Friday-Sunday 5AM-5:30PM or 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Must be Able to position header at machine clamping using an overhead or jib crane; turn cranks or pushes buttons to...
Stand-By Personnel - Tulsa, OK - 5 days ago
Facilities Tech B Pay: $18+/hr. Hours: Day Shift Job type: Temp (4-6 Months) Location: Catoosa, Oklahoma Job Description: This position involves comprehensive reporting and adept navigation of the maintenance CMMS system. Duties include conducting preventive maintenance and repairs on...
Stand-By Personnel - Tulsa, OK - 7 days ago
Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...
Stand-By Personnel - Tulsa, OK - 1 week ago
Repair Technician Lead Pay: $25-28/hr. Hours: Monday- Friday, Possible Weekends Job Type: Temp to Hire Location: Tulsa, Oklahoma Benefits: 401(k) matching, employee assistance program, life insurance Job Description: Seeking a proactive Repair Technician Lead experienced in commercial roofing...
Stand-By Personnel - Tulsa, OK - 7 days ago
Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...
Stand-By Personnel - Tulsa, OK - 1 week ago
Field Service Tech Pay: $45-65k/ YR Job type: Temp to Hire Location: Pryor, Oklahoma Must be willing to travel (FL, MS, AL, GA, OK). May be required to travel nationwide for installation. Hours depend on the customer's hours. Weekends are a possibility. Job Description: The Field Service...
Stand-By Personnel - Tulsa, OK - 7 days ago
Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...
Stand-By Personnel - Tulsa, OK - 5 days ago
Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...
Stand-By Personnel - Tulsa, OK - 1 week ago
This job was posted by : For more information, please see: Assembler {#aspanstylecolorblackstructuralassemblerspana}Pay: \$16-24hr. {#spanstylecolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylecolorblackd1624hrspan}Hours: Monday-Friday Day Shift {#spanstylecolorblackhoursspanspanstylecolorblackmondayfriday...
Stand-By Personnel - Tulsa, OK - 1 week ago
6G Fitter Welder (Spools) Pay: $27-28/hr. Hours: Monday-Friday 6AM-4:30PM (Saturday as needed) Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 6G Weld test Job Description: The role of the 6G Fitter Welder on Spools is pivotal in the fabrication and assembly of piping systems,...
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Welder Pay: $23-25/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Broken Arrow, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join our team. The Structural Welder will be responsible for fabricating...
Stand-By Personnel - Tulsa, OK - 7 days ago
Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...
Stand-By Personnel - Tulsa, OK - 7 days ago
Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Fitter Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: A pipe fitter welder is a skilled tradesperson who specializes in both pipe fitting and welding tasks. Their job description typically involves a combination...
Stand-By Personnel - Tulsa, OK - 7 days ago
Class A or B Welders Pay: $25-29/hr. DOE Hours: Monday- Friday 5AM-3:30PM. Job Type: Temp-Hire Location: Catoosa, Oklahoma Test_:_ 2G and 3G GMAW, FCAW. 2\" 6G Super coupon GMAW, FCAW. 2\" 6G XX GTAW. Job Description: Responsible for performing welding functions per job specifications....
Stand-By Personnel - Tulsa, OK - 7 days ago
Structural Fitter Pay: $22/hr. Hours: Day Shift 6AM-4:30PM Job type: Temp to Hire Location: Sapulpa, Oklahoma Weld Test: Fitters Test Job Description: We're seeking a skilled Structural Fitter welder to ensure precise fabrication and adherence to quality and safety standards. Your responsibilities...
Stand-By Personnel - Tulsa, OK - 1 week ago
Overhead Crane Field Service Technician Assistant Pay: $15-25/hr. Depending on experience Hours: 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: Join our team as an Overhead Crane Field Service Technician Assistant, where you'll play a crucial role in inspecting,...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Welder Pay: $27-28/hr. Hours: Monday-Thursday 6AM-4:30PM Job type: Temp to Hire Location: Catoosa, Oklahoma Job Description: The pipe welder's duties include reading blueprints to understand the layout and requirements of the piping system. They then prepare the material by cleaning,...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Welder Pay: $27+/hr. Hours: Friday-Sunday 6AM-6PM (Work 36 Paid 40) Job type: Temp to Hire Location: Tulsa, Oklahoma Benefits: Competitive hourly pay with opportunities for advancement. Comprehensive health and dental insurance. Retirement savings plan. Paid time off and holidays. Professional...
Stand-By Personnel - Tulsa, OK - 1 week ago
Pipe Welder Pay: $25-28/hr. Depends on experience. Shift Differential. Hours: Day and Night Shifts Available Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: Open Root 3G MIG/ Flux core Fill in Cap Test and a 6G TIG Root Flux Fill in cap on 2-inch Schedule 160. Job Description:...
Stand-By Personnel - Tulsa, OK
This job was posted by : For more information, please see: Fitter {#spanstylefontsize115ptcolorblackstructuralfitterspanspanstylefontsize115ptcolor666666span}Pay: \$22/hr. {#spanstylefontsize115ptcolorblackpayspanspanstylefontsize90ptcolorblackspanspanstylefontsize115ptcolorblackd22hrspan}Hours:...
Stand-By Personnel - Tulsa, OK - 7 days ago
Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Louver Welder Pay: $22+/hr (Based on experience) Hours: Monday- Friday 5PM-5:30AM Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The Structural Louver welder must have proficiency in welding fabricated parts of structural metal products...
Stand-By Personnel - Tulsa, OK - 5 days ago
Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...
Stand-By Personnel - Tulsa, OK - 7 days ago
Fitter Welder Pay: $25-28+/hr. Hours: Monday-Saturday 6AM-4:30PM Job type: Temp to Hire Location: Broken Arrow, Oklahoma Weld Test: 6G Test Job Description: As a Fitter/Welder, you will play a crucial role in the production process. The ideal candidate will have a minimum of 2 years...
Stand-By Personnel - Tulsa, OK - 1 week ago
Overhead Crane Field Service Technician Pay: $25-35/hr. Hours: Monday-Friday 8AM-4:30PM Job type: Temp to Hire Location: Claremore, Oklahoma Job Description: The Overhead Crane Field Service Technician Will Troubleshoot, repair, inspect, and upgrading industrial hoists and cranes in the...
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...
Stand-By Personnel - Tulsa, OK - 2 days ago
Fitter Welder Pay: $24-$32/hr. Multiple Shifts Available Location: Sand Springs, Oklahoma Must be able to pass drug test and background check. Shifts Available: Weekends: 6:00am-6:00pm OR 6:00pm-6:00am Friday-Sunday and some weekdays. Weekdays: 6:00am-6:00pm OR 6:00pm-6:00am 1 day off during...
Stand-By Personnel - Tulsa, OK - 1 week ago
CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...
Stand-By Personnel - Tulsa, OK - 1 week ago
Mig & Fluxcore Welder Pay: $20-25/hr. Hours: Monday-Friday 7AM-3:30PM Job type: Temp to Hire Location: Tulsa, Oklahoma Job Description: As a Welder, you'll play a crucial role in fabricating and assembling metal structures and components, employing a range of welding techniques. Precision,...
Stand-By Personnel - Tulsa, OK - 7 days ago
Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....
Stand-By Personnel - Tulsa, OK - 7 days ago
CNC Mill & Lathe Machinist Pay: $20-25/hr. Hours: 1st shift , 2nd shift and weekend shift available! Job Type: Temp to Hire Location: Tulsa, Oklahoma Job Requirements: Own or be willing to purchase the minimum set of tools required for the job and a locking toolbox. Prior knowledge of...
Stand-By Personnel - Tulsa, OK - 7 days ago
Structural Welder/Fitter Pay: $20-25/hr. Hours: Monday-Thursday 6AM-4:30PM OR 6AM-6:30PM Friday- Sunday Job type: Temp to Hire Location: Tulsa, Oklahoma Weld Tests: Fluxcore Vision test on beam and pipe, Uphill, overhead and flat on beam and flat on pipe. 3G Double bevel on 1\" plate butted...
Stand-By Personnel - Claremore, OK
This job was posted by : For more information, please see: Machinist Pay: \$19/hr +. DOE Hours: Friday- Sunday 6AM-4PM OR 5PM- 3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Will set up and operate planner type milling machine that moves work piece back and forth against rigidly...
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Fitter / Welder Pay: $21-23/hr. Hours: Monday- Friday 6AM-4:30PM Job Type:Temp-Hire Location: Tulsa, Ok Benefits: 401k, 401k Matching, Dental insurance, Health insurance, Paid time off and Vision insurance. Job Description: Must pass an Mig and flux core 3G weld test on a...
Stand-By Personnel - Tulsa, OK - 4 days ago
Structural Welder Pay: $26-27/hr. Hours: 5AM-4:30PM OR 5PM-4:30AM Job Type: Temp to Hire Location: North Owasso, Oklahoma Job Description: The Structural Welder performs welding tasks accurately and efficiently to meet project deadlines and quality expectations. Work autonomously with...
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Welder Pay: $22+/hr. Hours: Monday- Friday 5:30PM-3AM Job Type: Temp-Hire Location: Catoosa, Oklahoma Weld Test: Must pass 2G and 3G weld test (must have 2 years of experience and fitting experience) Job Description: Ability to weld fabricated parts of structural metal products...
Stand-By Personnel - Tulsa, OK - 5 days ago
Structural Welder Pay: $22+/hr. (Based on experience) Hours: Monday- Friday Day and Night shift Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G and 3G Weld Test Job Description: The role requires proficiency in welding fabricated parts of structural metal products within a shop...
Stand-By Personnel - Tulsa, OK - Yesterday
Structural Welder Pay: $18-22/hr. Hours: 6AM-4:30PM Job type: Temp to Hire Location: Owasso, Oklahoma Weld Test: 3G and 4G Mig Flux Core Job Description: As a Structural Welder with 3G and 4G, you will play a crucial role in the fabrication and assembly of various structural components....
Stand-By Personnel - Tulsa, OK - 1 week ago
Structural Steel Fitters/Mig Flux Welder Pay: $18+/hr. Hours: Monday-Friday 5AM-3:30PM Job Type: Temp to Hire Location: Tulsa, Oklahoma Test: 3G Weld test Job Description: We are seeking a skilled and experienced Structural Welder to join us!. The Structural Welder will be responsible for fabricating...
Stand-By Personnel - Tulsa, OK - 2 days ago
Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...
Stand-By Personnel - Tulsa, OK - 1 week ago
Weekend Structural Fitter Welder Pay: $25+/hr. Hours: Friday-Sunday 5:30PM-5AM (Work 36, paid 40) Job Type: Temp to Hire Location: Catoosa, Oklahoma Job Description: Structural Fitter should have the ability to lay out, fit, and weld fabricated components to assemble structural forms....
Stand-By Personnel - Tulsa, OK - 2 days ago
Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...
Stand-By Personnel - Tulsa, OK - 2 days ago
Traveling Field Service / Fitter Welder Pay: $28-30/hr. Hours: Varies Job Type: Temp to Hire Location: Oklahoma, Kansas, Arkansas Test: Must be able to pass a 3G and 6G weld test Must be able and willing to travel state to state. Job Description: We are seeking a Traveling Field Service /...
Stand-By Personnel - Tulsa, OK - 2 days ago
Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...
Stand-By Personnel - Claremore, OK
This job was posted by : For more information, please see: Coating Painter Pay: \$18-19/hr. Hours: Monday-Friday Day Shift Job Type: Temp-Hire Location: Catoosa, Oklahoma Job Description: Abrades surfaces of metal or hard composition objects to remove adhering scale, sand, paint, grease, tar, rust,...
Stand-By Personnel - Tulsa, OK - 2 days ago
Robotic Welder Pay: $25-30/hr. Hours: Nights Monday-Friday 5PM-3:30AM (train on days for 2 weeks) Job Type: Temp to Hire Location: Catoosa, Oklahoma Test: 2G Pulse MIG on ½ inch plate Job Description: The Robotic Welder Operator is responsible for setting up and operating computer-controlled...
Stand-By Personnel - Tulsa, OK - 1 week ago
Header Sub Arc/ Lance Operator Pay: $19+/hr. (Depending on experience) Hours: 5PM-5:30AM Job type: Temp to Hire Location: Catoosa, Oklahoma Weld Test: 1G Saw Plate Sub-Arc and 2G Plate Test (3years of experience required) Job Description: The ideal candidate will possess the ability...
Download our award winning mobile app and apply on the go.
We ♥ small businesses :-)
Dear Proven Customer,
Good news!
Proven has been acquired and is joining forces with Upward.net.
Over the past few months, the Upward.net technology team has been hard at work integrating some of the Proven features that you have grown accustomed to into the Proven platform.
Our objective is to combine the Proven features with the Upward.net job distribution platform so that you can get even more candidates and have more flexibility than before.
Here are a few things you should know.
If you have any questions about the transition, Upward.net's functionality or pricing, please contact us at support@upward.net or use the web chat functionality at Upward.net.
We are tremendously grateful to the thousands of customers who have helped us succeed over the past decade. We could not have done this without you...Thank you!
Nr | Query | Error | Affected | Num. rows | Took (ms) |
---|---|---|---|---|---|
1 | SELECT `UtZipcode`.`city`, `UtZipcode`.`state_prefix`, `UtZipcode`.`state_name`, `UtZipcode`.`zipcode`, `UtZipcode`.`lat`, `UtZipcode`.`lon`, Count(*) as size FROM `proven_production`.`ut_zipcodes` AS `UtZipcode` WHERE ((`UtZipcode`.`city` = 'tulsa') OR (`UtZipcode`.`state_name` = 'tulsa') OR (`UtZipcode`.`state_prefix` = 'tulsa') OR (`UtZipcode`.`county` = 'tulsa') OR (`UtZipcode`.`zipcode` = 'tulsa')) GROUP BY `UtZipcode`.`city`, `UtZipcode`.`state_prefix` ORDER BY `size` DESC, `UtZipcode`.`city` ASC, `UtZipcode`.`state_prefix` ASC LIMIT 1 | 1 | 1 | 358 | |
2 | SELECT `CustomerSupportedLocation`.`id`, `CustomerSupportedLocation`.`name`, `CustomerSupportedLocation`.`state`, `CustomerSupportedLocation`.`state_expanded`, `CustomerSupportedLocation`.`paid_area`, `CustomerSupportedLocation`.`lat`, `CustomerSupportedLocation`.`lon`, `CustomerSupportedLocation`.`background_class`, `CustomerSupportedLocation`.`key_value`, `CustomerSupportedLocation`.`pricing_plan_id`, `CustomerSupportedLocation`.`subscription_plan_id`, `CustomerSupportedLocation`.`created_date`, `CustomerSupportedLocation`.`posting_fee`, `CustomerSupportedLocation`.`city` FROM `proven_production`.`customer_supported_locations` AS `CustomerSupportedLocation` WHERE 1 = 1 ORDER BY `name` ASC | 427 | 427 | 3 | |
3 | SELECT `CustomerSupportedLocation`.`id`, `CustomerSupportedLocation`.`name`, `CustomerSupportedLocation`.`state`, `CustomerSupportedLocation`.`state_expanded`, `CustomerSupportedLocation`.`paid_area`, `CustomerSupportedLocation`.`lat`, `CustomerSupportedLocation`.`lon`, `CustomerSupportedLocation`.`background_class`, `CustomerSupportedLocation`.`key_value`, `CustomerSupportedLocation`.`pricing_plan_id`, `CustomerSupportedLocation`.`subscription_plan_id`, `CustomerSupportedLocation`.`created_date`, `CustomerSupportedLocation`.`posting_fee`, `CustomerSupportedLocation`.`city` FROM `proven_production`.`customer_supported_locations` AS `CustomerSupportedLocation` WHERE `CustomerSupportedLocation`.`lat` >= 35.347662318841 AND `CustomerSupportedLocation`.`lat` <= 36.796937681159 AND `CustomerSupportedLocation`.`lon` >= -96.798524083787 AND `CustomerSupportedLocation`.`lon` <= -95.005475916213 ORDER BY rad_distance(`CustomerSupportedLocation`.`lat`, `CustomerSupportedLocation`.`lon`, 36.0723, -95.902) ASC LIMIT 1 | 1 | 1 | 1 | |
4 | SELECT `CustomerSupportedLocation`.`id`, `CustomerSupportedLocation`.`name`, `CustomerSupportedLocation`.`state`, `CustomerSupportedLocation`.`state_expanded`, `CustomerSupportedLocation`.`paid_area`, `CustomerSupportedLocation`.`lat`, `CustomerSupportedLocation`.`lon`, `CustomerSupportedLocation`.`background_class`, `CustomerSupportedLocation`.`key_value`, `CustomerSupportedLocation`.`pricing_plan_id`, `CustomerSupportedLocation`.`subscription_plan_id`, `CustomerSupportedLocation`.`created_date`, `CustomerSupportedLocation`.`posting_fee`, `CustomerSupportedLocation`.`city` FROM `proven_production`.`customer_supported_locations` AS `CustomerSupportedLocation` WHERE 1 = 1 ORDER BY `name` ASC | 427 | 427 | 3 |